PRGDB00080581 (Mgu.15953)

From PRG Wiki
Jump to: navigation, search
Mgu.15953
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238207018 (GR082298)
Gene Class Unknown
Domain Type LRR
Gene Species Cucumis x hytivus

Comment?

CCIF15714.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF15714 5', mRNA sequence

DNA Sequence

AGTCGATACGCCATCTCGTAATATCGCAATCAGAGCAGATATTTGGAACATGCTTCATTTAAGGCATCTAAAGACGAATGCATCTGCATCTTTGCCCAAGAGAGATAGCAGTGACAAAGGAGGTCAAAAGCTTCAAACACTTGATACAATCTCACCACAAAGTTGCTCCGAACAAGTTTTTGACACGGCTTGTAATTTAAAGAAATTAGGCATTCGTGGCCCGCTAGCCTCGCTGATTGACGGCAAGATCGGGTCATTTGGCATCTTAAGAAAAATGGATCATCTTGAAAATCTGAAGCTACTAAATGATGTATTTCCCCGTCCAGCTTCGGAAGGTCAGCTACGGTACCTTCCTCAGCCGTACGAGTTCCCACCGAAACTGAAGAGCCTAACATTATCCGATACTTCTCTCGACTGGAGTCATATGCCTATTCTAGGATCACTGGAGAAATTAATTGTTCTTAAGCTAAAAGATAATGCATTCATGGGGGAGATATGGAAAACAGCCGATGGAGGGTTTCGCCATCTCGAGGTCTTGCATATTGGACCGACAAATTTAGTTGTTTGGAGAGCTTCAGACCGTCACTTCCCGAAGCTCAGACGCCTTGAGCTCTACAACTGCGAAGAACTCGTACAAGTTCCGATCGGACTTGCCGATATACAGAGCCTCCAATTTTTGGAATTGAACTGTTCGAACTTTGCAGCTGCCTCTGCAAAAAAAATCCGCAATATAAAGAAGCAACAGGTCAGCATATTCAAGCTCTCCGTTTTTCCACCTCTGATGAGTGATCGCCCGTAACGGTTCTACTGGATA


Protein sequences

Name Description Sequence
Mgu.15953 translated coding region predicted by ESTScan from UniGene Mgu.15953

XVDTPSRNIAIRADIWNMLHLRHLKTNASASLPKRDSSDKGGQKLQTLDTISPQSCSEQVFDTACNLKKLGIRGPLASLIDGKIGSFGILRKMDHLENLKLLNDVFPRPASEGQLRYLPQPYEFPPKLKSLTLSDTSLDWSHMPILGSLEKLIVLKLKDNAFMGEIWKTADGGFRHLEVLHIGPTNLVVWRASDRHFPKLRRLELYNCEELVQVPIGLADIQSLQFLELNCSNFAAASAKKIRNIKKQQVSIFKLSVFPPLMSDRPXRFYWI

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
114-234 L domain-like,LRR

QLRYLPQPYEFPPKLKSLTLSDTSLDWSHMPILGSLEKLIVLKLKDNAFMGEIWKTADGGFRHLEVLHIGPTNLVVWRASDRHFPKLRRLELYNCEELVQVPIGLADIQSLQFLELNCSNF

HMMPanther: PTHR23155
114-229 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QLRYLPQPYEFPPKLKSLTLSDTSLDWSHMPILGSLEKLIVLKLKDNAFMGEIWKTADGGFRHLEVLHIGPTNLVVWRASDRHFPKLRRLELYNCEELVQVPIGLADIQSLQFLEL

Gene3D: G3DSA:3.80.10.10
119-246 no description

PQPYEFPPKLKSLTLSDTSLDWSHMPILGSLEKLIVLKLKDNAFMGEIWKTADGGFRHLEVLHIGPTNLVVWRASDRHFPKLRRLELYNCEELVQVPIGLADIQSLQFLELNCSNFAAASAKKIRNIK

Seg: seg
127-141 seg

KLKSLTLSDTSLDWS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox