PRGDB00080607 (Mgu.18776)

From PRG Wiki
Jump to: navigation, search
Mgu.18776
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238203895 (GR082076)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Cucumis x hytivus

Comment?

CCIF15590.g1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF15590 3', mRNA sequence

DNA Sequence

GGCCGCCCTTTTTTTTTTTTTTTCCGATCCTTCAAACTCCCATTTCCGACCGGACCCACCGCCCTCTTCGTTCCTCAATATTTTCCCGCCTCTTTCCTCTCCCCTGCCGCCATTGGTCGGATCGTACGACTGATTTGCCAGGTAAGAAAGTGCAGTTACAACATCACCAATCAAAGGGCGAGCAGCAGCTTGTTCTTGGATGCACATGGAAGCTACAGCCAATGCTTGGTACAGTCCGCGCATCGGAAATTTGCCCTGCAGTATCGGGTCCGCCAGCTTGGCGAATTTTCTACGGTCGTTGAACAACGGCCTTGCCCATGCCACGAGGTTTTGTTCGCCTTGAGGTCGAGTGCTGTCAATAGCTTTACGCCCCGTAATAAGCTCCAAGAAGACGACACCGAAACTGTAGACATCGGACTTGACGGTCAACTGCCCAGTCATCGCATATTCAGGAGCGCAGTAGCCGTAAGTGCCCATAACCCTAGTGGATACATGCGACTTGTCGCCCGTGGGGCCCAGCTTCGCGAGTCCGAAATCGGAAAGCTTTGGAGCAAACTCTTCGCCTAGCAATATGTTGGATGACTTGAAATCCCGATAAATAACGGGCGGGTTCGCCTTGTCGTGCAGGTACTCCAACCCTCTCGCTGCACCTGCAGCTATCTTCATTCTTGTGCTCCAATCGAGCGCTTCTTTGTCCGGTGGAGATCATGGAGATGATCTTCTAAAGAACCCAACGGCATGAACTCGTAGACGAGAAGCCTTTGATCCCCGTCGCGCAGTACCCATCAG


Protein sequences

Name Description Sequence
Mgu.18776 translated coding region predicted by ESTScan from UniGene Mgu.18776

LMGTARRGSKASRLRVHAVGFFRRSSPXSPPDKEALDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVAWARPLFNDRRKFAKLADPILQGKFPMRGLYQALAVASMCIQEQAAARPLIGDVVTALSYLANQSYDPTNGGRGEERGGKILRNEEGGGSGRKW

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-217 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LMGTARRGSKASRLRVHAVGFFRRSSPXSPPDKEALDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVAWARPLFNDRRKFAKLADPILQGKFPMRGLYQALAVASMCIQEQAAARPLIGDVVTALSYL

HMMSmart: SM00219
IPR020635
1-214 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LMGTARRGSKASRLRVHAVGFFRRSSPXSPPDKEALDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVAWARPLFNDRRKFAKLADPILQGKFPMRGLYQALAVASMCIQEQAAARPLIGDVVTAL

HMMSmart: SM00220
IPR002290
2-217 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MGTARRGSKASRLRVHAVGFFRRSSPXSPPDKEALDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVAWARPLFNDRRKFAKLADPILQGKFPMRGLYQALAVASMCIQEQAAARPLIGDVVTALSYL

HMMPanther: PTHR24420
30-224 FAMILY NOT NAMED,FAMILY NOT NAMED

PPDKEALDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVAWARPLFNDRRKFAKLADPILQGKFPMRGLYQALAVASMCIQEQAAARPLIGDVVTALSYLANQSYDP

HMMPanther: PTHR24420:SF657
30-224 SUBFAMILY NOT NAMED

PPDKEALDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVAWARPLFNDRRKFAKLADPILQGKFPMRGLYQALAVASMCIQEQAAARPLIGDVVTALSYLANQSYDP

HMMPfam: PF00069
IPR017442
33-157 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KEALDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVA

Gene3D: G3DSA:1.10.510.10
34-214 no description

EALDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVAWARPLFNDRRKFAKLADPILQGKFPMRGLYQALAVASMCIQEQAAARPLIGDVVTAL

superfamily: SSF56112
IPR011009
36-214 Protein kinase-like (PK-like)
Protein kinase-like domain

LDWSTRMKIAAGAARGLEYLHDKANPPVIYRDFKSSNILLGEEFAPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRPQGEQNLVAWARPLFNDRRKFAKLADPILQGKFPMRGLYQALAVASMCIQEQAAARPLIGDVVTAL

PatternScan: PS00108
IPR008271
63-75 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox