PRGDB00080608 (Mgu.18799)

From PRG Wiki
Jump to: navigation, search
Mgu.18799
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238203198 (GR071171)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Cucumis x hytivus

Comment?

CCIF9271.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF9271 5', mRNA sequence

DNA Sequence

AGCAAGAGGGCTACTTTACCTTCACCAAGATTCGAGATTGAGGATCATTCATCGAGATATGAAAACAAGCAACATTCTACTAGATGAAGATATGAATCCCAAGATATCGGATTTTGGCTTGGCAAAGATTGTCGAAGGCAAAGAAACAGAGGCAAGTACCAACAGAGTTGTCGGCACCTATGGGTATATGTCTCCAGAGTACGCATTAGACGGGAAATTCTCGATAAAGTCGGATGTGTTCAGTTTCGGAGTTGTGATGCTTGAGATAATCAGTGGGAAGAAGAACACCGGTTTCTATAACCCTCAACAAGTCTTAAATCTCCTTGGATATGCGTGGGGATTGTGGATTGAAAACAAGGCAATCGAGTTGGTTGATCCGGTGGTGGTAGAATCATGCGAGGAATGTGAAGTGATGAAATGCATAAATGTTGGGCTGCTGTGCGTGCAAGAAGACCCGAACGATCGGCCATCCATGTCAACTGTAGTTGTAATGATTGGCAGTGAAAACACGACCTCTCTTCCGAACCCGACAAAACCGGCCTTTGTAGTGAGGAGACATCATTCAAGCACATCTTCCTCCACCTCCACAAAACCTGCTACCATCTCCACCAATCTGCTGACTGTTTCTATGGAAGAGGGGCGATAAGGGGTTGTTTTATATATATATATATATGATCACTTAAATTTATGTTTTCTTATCTTCCTTCCCGGTTACTCTAGGCACATCCATTGAGCATATTCCGGGCACAAGAATATTGACACGCATCTAGTGTAACCAGCTCTTTTTGTTTTTCTGTGTGTGTGAATTTTGTAGAAGAAATTGAAAATT


Protein sequences

Name Description Sequence
Mgu.18799 translated coding region predicted by ESTScan from UniGene Mgu.18799

XARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYNPQQVLNLLGYAWGLWIENKAIELVDPVVVESCEECEVMKCINVGLLCVQEDPNDRPSMSTVVVMIGSENTTSLPNPTKPAFVVRRHHSSTSSSTSTKPATISTNLLTVSMEEGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-182 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYNPQQVLNLLGYAWGLWIENKAIELVDPVVVESCEECEVMKCINVGLLCVQEDPNDRPSMSTVVVMIGSENTTSLPNPTKPAF

superfamily: SSF56112
IPR011009
2-166 Protein kinase-like (PK-like)
Protein kinase-like domain

ARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYNPQQVLNLLGYAWGLWIENKAIELVDPVVVESCEECEVMKCINVGLLCVQEDPNDRPSMSTVVVMI

Gene3D: G3DSA:1.10.510.10
2-163 no description

ARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYNPQQVLNLLGYAWGLWIENKAIELVDPVVVESCEECEVMKCINVGLLCVQEDPNDRPSMSTVV

HMMPfam: PF00069
IPR017442
2-101 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYN

HMMPanther: PTHR24420:SF703
2-213 SUBFAMILY NOT NAMED

ARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYNPQQVLNLLGYAWGLWIENKAIELVDPVVVESCEECEVMKCINVGLLCVQEDPNDRPSMSTVVVMIGSENTTSLPNPTKPAFVVRRHHSSTSSSTSTKPATISTNLLTVSMEE

HMMSmart: SM00219
IPR020635
2-166 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYNPQQVLNLLGYAWGLWIENKAIELVDPVVVESCEECEVMKCINVGLLCVQEDPNDRPSMSTVVVMI

HMMSmart: SM00220
IPR002290
2-166 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYNPQQVLNLLGYAWGLWIENKAIELVDPVVVESCEECEVMKCINVGLLCVQEDPNDRPSMSTVVVMI

HMMPanther: PTHR24420
2-213 FAMILY NOT NAMED,FAMILY NOT NAMED

ARGLLYLHQDSRLRIIHRDMKTSNILLDEDMNPKISDFGLAKIVEGKETEASTNRVVGTYGYMSPEYALDGKFSIKSDVFSFGVVMLEIISGKKNTGFYNPQQVLNLLGYAWGLWIENKAIELVDPVVVESCEECEVMKCINVGLLCVQEDPNDRPSMSTVVVMIGSENTTSLPNPTKPAFVVRRHHSSTSSSTSTKPATISTNLLTVSMEE

PatternScan: PS00108
IPR008271
16-28 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDMKTSNILL

Seg: seg
128-138 seg

VVVESCEECEV

HMMPfam: PF11883
IPR021820
171-215 DUF3403
S-locus receptor kinase, C-terminal

TTSLPNPTKPAFVVRRHHSSTSSSTSTKPATISTNLLTVSMEEGR

Seg: seg
189-204 seg

SSTSSSTSTKPATIST






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox