PRGDB00080619 (Mgu.19770)

From PRG Wiki
Jump to: navigation, search
Mgu.19770
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238201646 (GR072202)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Cucumis x hytivus

Comment?

CCIF10165.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF10165 5', mRNA sequence

DNA Sequence

ATTTGGTATTGTTTACAAGGGAAAACTTCAAAATGGTCAAGAAATAGCAGTGAAAAGGTTGTCGAGGAATTCAGGGCAAGGGGATGTAGAATTCAAGAATGAAGTGTTGTTGGTTGCCAAACTTCAGCACAGAAACTTGGTTAGGCTATTGGGATTTTCTATCGAAGGAACCGAGAGGCTTCTAGTATATGAGTTCGTTCGGAATGCCAGCCTAGACCTCTTCATATTTGATCCGACTAGACGTACATCTATGGATTGGGACAGACGTTACGAGATCATAGGAGGCATCGCAAAGGGACTTCTTTATCTCCACGAGGATTCCCGTTTTCGTATTATACATCGTGATCTCAAAGCTAGCAATATCTTACTAGACGGAGATATGAATCCGAAAATAGCAGATTTTGGTATGGCGAGATTGTTTCGGCCAGAAGAAAGTGAAGGCAATACCAGCAGAATCGCCGGAACCTATGGATACATGGCGCCAGAGTATGCAATGCATGGTCAGTTCTCGGTGAAATCTGACGTGTTTAGCTTCGGTGTGCTAGTCTTGGAGATTATTACGGGGCAGAAAAATACTGCTTTTCGGAACGAGGACAATAATGTAGAGGATATGCTAAGTTGTGTATGGAGAAATTGGCGCGAGGGAAGATCGATAAACGTGGTAGATCCCGGTTTTGAGGTCGGGTTCGGGTTCAGTGAGGGATATGTTGAGATGCATTCATATTGGCTTGTTGTGCGTTCAGGAAAATGCAGTCGACAGACCTACAATGGCGTCGATGTTTTGATGCTGCATAGC


Protein sequences

Name Description Sequence
Mgu.19770 translated coding region predicted by ESTScan from UniGene Mgu.19770

XFGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGFSIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNNVEDMLSCVWRNWREGRSINVVDPGFEVGFGFSEGYVEMHSYWLVVRSGKCSRQTYNGVDVLMLHS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XFGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGFSIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNNVEDMLSCVWRNWREGRSINVVDPGFEVGFGFSEGYVEMHSYWLVVRSGKCSRQTYNGVDVLMLHS

HMMPfam: PF00069
IPR017442
2-201 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGFSIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNN

superfamily: SSF56112
IPR011009
2-214 Protein kinase-like (PK-like)
Protein kinase-like domain

FGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGFSIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNNVEDMLSCVWRNWR

Gene3D: G3DSA:3.30.200.20
2-53 no description

FGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGF

HMMSmart: SM00220
IPR002290
2-237 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGFSIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNNVEDMLSCVWRNWREGRSINVVDPGFEVGFGFSEGYV

HMMPanther: PTHR24420
2-224 FAMILY NOT NAMED,FAMILY NOT NAMED

FGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGFSIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNNVEDMLSCVWRNWREGRSINVVDP

HMMPanther: PTHR24420:SF430
2-224 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGFSIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNNVEDMLSCVWRNWREGRSINVVDP

HMMSmart: SM00219
IPR020635
2-237 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGIVYKGKLQNGQEIAVKRLSRNSGQGDVEFKNEVLLVAKLQHRNLVRLLGFSIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNNVEDMLSCVWRNWREGRSINVVDPGFEVGFGFSEGYV

Gene3D: G3DSA:1.10.510.10
54-211 no description

SIEGTERLLVYEFVRNASLDLFIFDPTRRTSMDWDRRYEIIGGIAKGLLYLHEDSRFRIIHRDLKASNILLDGDMNPKIADFGMARLFRPEESEGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEIITGQKNTAFRNEDNNVEDMLSCVWR

PatternScan: PS00108
IPR008271
112-124 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox