PRGDB00080624 (Mgu.20021)

From PRG Wiki
Jump to: navigation, search
Mgu.20021
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238209658 (GR078902)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Cucumis x hytivus

Comment?

CCIF13843.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF13843 5', mRNA sequence

DNA Sequence

GGACCTCGAAGAAGCAACCAACAAGTTCAGCCACGAAAACTTGATTGGAGAGGGAGGATATTCCGAAGTGTACAAGGGACATTTGGAAGACGGGCAATTAGTGGCGGTGAAAAGGTTAATTAGGGGAACCCAGGAAGAAATGACGGCCGATTACTTATCCGAGCTCGGTATTTTGGTCCACGTGAACCATCCAAACATTGCGGGTGTTATTGGCTATGGTGTTGAAGGAGGGATGCACCTTGTTCTTCCTTTGTCTCCTAATGGGAGCTTGTCATCCGTGCTAAACGAGAAAAAGGAGGAACTTACATGGAGCCTTAGATACAATATTGCCATGGGAATTGCGTCCGGTCTTTCTTATCTTCACGAGGGGTGCCAAAGAAGAATTATCCACCGAGATATTAAGTCTGCCAATATTTTGCTCACCGAAGATTTTGAACCTCAGATTTCAGACTTCGGGCTCGCGAAATGGCTTCCAGATCAATGGACTCATCTAACCGTTTCACAATTTGAAGGCACATTTGGATATCTCCCTCCGGAGTTTTTCATGCACGGCATAGTCGATGAAAAAACCGATGTATACGCATTTGGAGTGCTATTGCTAGAGCTTATTAGTGGCCGCCCGGCTATAGACGACGCACATAATAGTGTCGTGATGTGGGCCAAACCTCTGATAAATAATAAAAGTAACACGGAGATAGTCGATCCATCACTCGACGATGATTACGACTGGGATCAGCTGAATCGGATGGTCATGGTTTGCTTCTTTATGTATTCATCAATGTTCAACAGACAGGCCTCAAATGAACCA


Protein sequences

Name Description Sequence
Mgu.20021 translated coding region predicted by ESTScan from UniGene Mgu.20021

XDLEEATNKFSHENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGVIGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNSVVMWAKPLINNKSNTEIVDPSLDDDYDWDQLNRMVMVCFFMYSSMFNRQASNEP

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-257 Protein kinase-like (PK-like)
Protein kinase-like domain

DLEEATNKFSHENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGVIGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNSVVMWAKPLINNKSNTEIVDPSLDDDYDWDQLNRMVMVCFFM

Gene3D: G3DSA:3.30.200.20
2-70 no description

DLEEATNKFSHENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGV

HMMPanther: PTHR24420:SF794
2-253 SUBFAMILY NOT NAMED

DLEEATNKFSHENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGVIGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNSVVMWAKPLINNKSNTEIVDPSLDDDYDWDQLNRMVMV

HMMPanther: PTHR24420
2-253 FAMILY NOT NAMED,FAMILY NOT NAMED

DLEEATNKFSHENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGVIGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNSVVMWAKPLINNKSNTEIVDPSLDDDYDWDQLNRMVMV

ProfileScan: PS50011
IPR000719
10-270 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSHENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGVIGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNSVVMWAKPLINNKSNTEIVDPSLDDDYDWDQLNRMVMVCFFMYSSMFNRQASNEP

HMMSmart: SM00219
IPR020635
10-257 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSHENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGVIGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNSVVMWAKPLINNKSNTEIVDPSLDDDYDWDQLNRMVMVCFFM

HMMSmart: SM00220
IPR002290
10-262 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSHENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGVIGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNSVVMWAKPLINNKSNTEIVDPSLDDDYDWDQLNRMVMVCFFMYSSMF

HMMPfam: PF00069
IPR017442
13-218 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ENLIGEGGYSEVYKGHLEDGQLVAVKRLIRGTQEEMTADYLSELGILVHVNHPNIAGVIGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNSVV

PatternScan: PS00107
IPR017441
16-38 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGYSEVYKGHLEDGQLVAVK

Gene3D: G3DSA:1.10.510.10
71-216 no description

IGYGVEGGMHLVLPLSPNGSLSSVLNEKKEELTWSLRYNIAMGIASGLSYLHEGCQRRIIHRDIKSANILLTEDFEPQISDFGLAKWLPDQWTHLTVSQFEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELISGRPAIDDAHNS

PatternScan: PS00108
IPR008271
129-141 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox