PRGDB00080627 (Mgu.20282)

From PRG Wiki
Jump to: navigation, search
Mgu.20282
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238215211 (GR086218)
Gene Class Mlo-like
Domain Type MLO
Gene Species Cucumis x hytivus

Comment?

CCIF17871.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF17871 5', mRNA sequence

DNA Sequence

AAAAAATGGAGAAAAACATTCACACTTGATTTGTTTTTTATTCAATTTTTTTTATATTTTTTTATCAATAAGAAAAAGAAAAAAAAAATATGGCCGGAGGAGGAAGCGCGGCGGAATCACGGGAGCTCGACCATACTCCGACGTGGGCGGTTTCGTTAGTGTGTGGAATCATCATTGTTATCTCTATAATATTGGAGAAAACTCTTCATAAAGTCGGTGAGACATTTCATAAGAGAAAGAAGTTTTCATTGGTTGAAGCTTTGGAGAAAATTAAAGCAGAGCTTATGGTATTGGGATTCATTTCCCTACTTCTAACATTTGGGCAGAACTTCATTACACAAATATGCATACCGGATAAACTCGCAAACACAATGTTGCCGTGTGATTTTAAAACGAAATCGAAAGCGCATCACCATCCCGACCCTGAACCAGAACACGAACCCGAACACCACCGTAGGCTCCTGTGGAACGAGCATCGGATTTTGGCTGTCGACAGTACACCTAAAGATTGCAAAGATGTAAGAATGTGCATGCACTTTACGTGTTCGATAAAATGTCCGTGTGGAAAAAAAAAGTTACGTTGATCGAACAAGTGTTTTGTGCTAACGTACAGGGATACGTGCCTCTTATATCTGCACACGGACTTCACCAACTTCACATATTCATATTCTTTTTAGCCGTGTTCCATGTTTTCTACAGCGCTATAACGATGATGCTGGGGAGATTGAAGATTCGAGGATGGAAAGACTGGAACGACAGATTTTAGAAGAACACGAAGCGTCCACGATCCTT


Protein sequences

Name Description Sequence
Mgu.20282 translated coding region predicted by ESTScan from UniGene Mgu.20282

MAGGGSAAESRELDHTPTWAVSLVCGIIIVISIILEKTLHKVGETFHKRKKFSLVEALEKIKAELMVLGFISLLLTFGQNFITQICIPDKLANTMLPCDFKTKSKAHHHPDPEPEHEPEHHRRLLWNEHRILAVDSTPKDCKDXKNVHALYVFDKMSVWKKKVTLIEQVFCANVQGYVPLISAHGLHQLHIFIFFLAVFHVFYSXYNDDAGEIEDSRMERLERQILEEHEASTIL

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
9-211 Mlo
Mlo-related protein

ESRELDHTPTWAVSLVCGIIIVISIILEKTLHKVGETFHKRKKFSLVEALEKIKAELMVLGFISLLLTFGQNFITQICIPDKLANTMLPCDFKTKSKAHHHPDPEPEHEPEHHRRLLWNEHRILAVDSTPKDCKDXKNVHALYVFDKMSVWKKKVTLIEQVFCANVQGYVPLISAHGLHQLHIFIFFLAVFHVFYSXYNDDAG

Seg: seg
27-34 seg

IIIVISII

Seg: seg
107-121 seg

HHHPDPEPEHEPEHH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox