PRGDB00080684 (Ncr.30103)

From PRG Wiki
Jump to: navigation, search
Ncr.30103
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 213901041 (GH117544)
Gene Class Unknown
Domain Type
Gene Species Physcomitrella patens subsp. patens

Comment?

G993P150RA14.T0 Neurospora crassa cDNA - 1 hour Glucose Deprivation After 9 hours Vegetative Growth Neurospora crassa cDNA, mRNA sequence

DNA Sequence

AGGGACGACCTCATCGGGGCCGAACGCATCGATCCTCAACTCGCCATGAAGGTTCTTATGCAGTTCGATCGAGTTATCACTGAGGCTCTCAGTGAGAAAGTCAAGGCCCGTTTGACCTTCAAGGGATCTCTTGACACCTATCGCTTCTGCGACGAGGTCTGGACTTTCCTCATCAAGAACGTCACCTTCAAGATGGATGGCGGTCAGTCTGTTGTCACGGCGGACAAGGTCAAGATCGTGAGCTGCAGCGCAAAGCGCAGTGACGAGAAGTAGAACCGAGACGATCGAGAACAGTTCAAGACGGAGAAGTCGACCAGCCCATGCCGCGTCAAAACCGGAACTTTACTTCAAAAAGTATCCCTATCTCCAGGCCCAAAGGGTGGCACCTTTTATTATCCCGTCAAGAAGAAGCATCGAGGATGGGGTAATCATTGCACAGCACGCAGTATAGCCACGCTCTTCGAGACGGGCGAGCTT


Protein sequences

Name Description Sequence
Ncr.30103 translated coding region predicted by ESTScan from UniGene Ncr.30103

RDDLIGAERIDPQLAMKVLMQFDRVITEALSEKVKARLTFKGSLDTYRFCDEVWTFLIKNVTFKMDGGQSVVTADKVKIVSCSAKRSDEKXNRDDREQFKTEKSTSPCRVKTGTLLQKVSLSPGPKGGTFYYPVKKKHRGWGNHCTARSIATLFETGEL

Domains

Domain Start-End Description Sequence

superfamily: SSF47396
IPR009083
2-35 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

DDLIGAERIDPQLAMKVLMQFDRVITEALSEKVK

HMMPfam: PF02268
IPR015872
2-31 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

DDLIGAERIDPQLAMKVLMQFDRVITEALS

BlastProDom: PD009224
IPR015872
2-30 Q7SEH7_NEUCR_Q7SEH7;
Transcription initiation factor IIA, gamma subunit

DDLIGAERIDPQLAMKVLMQFDRVITEAL

Gene3D: G3DSA:1.10.287.190
IPR015872
2-35 no description
Transcription initiation factor IIA, gamma subunit

DDLIGAERIDPQLAMKVLMQFDRVITEALSEKVK

HMMPanther: PTHR10966
IPR003194
2-95 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

DDLIGAERIDPQLAMKVLMQFDRVITEALSEKVKARLTFKGSLDTYRFCDEVWTFLIKNVTFKMDGGQSVVTADKVKIVSCSAKRSDEKXNRDD

superfamily: SSF50784
IPR009088
33-85 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

KVKARLTFKGSLDTYRFCDEVWTFLIKNVTFKMDGGQSVVTADKVKIVSCSAK

HMMPfam: PF02751
IPR015871
33-83 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

KVKARLTFKGSLDTYRFCDEVWTFLIKNVTFKMDGGQSVVTADKVKIVSCS

Gene3D: G3DSA:2.30.18.10
IPR009088
37-90 no description
Transcription factor IIA, beta-barrel

RLTFKGSLDTYRFCDEVWTFLIKNVTFKMDGGQSVVTADKVKIVSCSAKRSDEK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox