PRGDB00080686 (Ncr.30659)

From PRG Wiki
Jump to: navigation, search
Ncr.30659
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 218204509 (GH273533)
Gene Class Unknown
Domain Type
Gene Species Physcomitrella patens subsp. patens

Comment?

G688P549RE11.T0 Neurospora crassa cDNA - 4 hours Vegetative Growth in constant light Neurospora crassa cDNA, mRNA sequence

DNA Sequence

CCGGGCTGCAGGAATTCGGCACGAGGGCGAGCTCAATAACCTTTCCGAGCTTGTCCACAGGGTTTCCCCCGACACCCTCGTCATTGTCGATGGTGTCTGCTCCGTCGCCTGTGAGGAGATTGACTTTGATGCCTGGAAGCTCGACGGTGTTGTCACTGCCTCCCAGAAAGCCATCGGCTGCCCTGCCGGTCTCTCTATCTCCATGTTCAGCGGTCGCGCCATCCAGGCCTTCCAGAACCGCCAGACTCCACCGACCTCTTACTTTGCTTCAATGAAGAACTGGCTGCCCATCATGCAGAACTACGAGGCCAAGAAGCCCTCCTACTTCGCCACTCCTTCTCCCCAGCTCGTTCGCGCCCTCCATACCGCCCTTGGCCAGATCGTCGCCCAGGGTGTCAAGGAAAGGTTCGCGGCCCACAAGGCGGCTTCGGACAAGATCAAGGCGGCCGTTGCTGCTCTCGGCCTCAAGCAGGTCGCCGCCAACCCTGATGACCAGGCCCACGGCATGACCGCCATCTACCTTCCCGAGAACGTCAAGGGCGCTGAGCTCCTCCCCAAGCTCGCTTCGAGGGGCGTCGTGTTCGCCGGTGGCATTCACAAGGCCATTGCGGCCAAGTACATCCGTTTTGGTCACATGGGCGTCAGTGTGTTGGATCCTAGCAGAGGCCATGTCGAGAAGGCCATCAAGGCTctcgaggggggcccggtacccaattcgccctatagtgagtcgtatACATTCACTGGCGTCGTTTACACGTCGTGACTGGGAAACCCTGCGTACCCACTAATCGCTTGCAGCACATCCCCTTTCGCCAGCTGGCGTAATAGCGAGA


Protein sequences

Name Description Sequence
Ncr.30659 translated coding region predicted by ESTScan from UniGene Ncr.30659

XRAAGIRHEGELNNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEAKKPSYFATPSPQLVRALHTALGQIVAQGVKERFAAHKAASDKIKAAVAALGLKQVAANPDDQAHGMTAIYLPENVKGAELLPKLASRGVVFAGGIHKAIAAKYIRFGHMGVSVLDPSRGHVEKAIKALEGGPVPNSPYSESYTFTGVVYTSXLGNPAYPLIACSTSPFASWRNSEX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152
3-233 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

AAGIRHEGELNNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEAKKPSYFATPSPQLVRALHTALGQIVAQGVKERFAAHKAASDKIKAAVAALGLKQVAANPDDQAHGMTAIYLPENVKGAELLPKLASRGVVFAGGIHKAIAAKYIRFGHMGVSVLDPSRGHVEKAIKALE

HMMPanther: PTHR21152:SF7
3-233 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AAGIRHEGELNNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEAKKPSYFATPSPQLVRALHTALGQIVAQGVKERFAAHKAASDKIKAAVAALGLKQVAANPDDQAHGMTAIYLPENVKGAELLPKLASRGVVFAGGIHKAIAAKYIRFGHMGVSVLDPSRGHVEKAIKALE

superfamily: SSF53383
IPR015424
12-233 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

LNNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEAKKPSYFATPSPQLVRALHTALGQIVAQGVKERFAAHKAASDKIKAAVAALGLKQVAANPDDQAHGMTAIYLPENVKGAELLPKLASRGVVFAGGIHKAIAAKYIRFGHMGVSVLDPSRGHVEKAIKALE

HMMPfam: PF00266
IPR000192
12-203 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LNNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEAKKPSYFATPSPQLVRALHTALGQIVAQGVKERFAAHKAASDKIKAAVAALGLKQVAANPDDQAHGMTAIYLPENVKGAELLPKLASRGVVFAGGIHKAI

Gene3D: G3DSA:3.40.640.10
IPR015421
13-118 no description
Pyridoxal phosphate-dependent transferase, major r

NNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEAKKPSYFATPSPQLV

Gene3D: G3DSA:3.90.1150.10
IPR015422
119-233 no description
Pyridoxal phosphate-dependent transferase, major r

RALHTALGQIVAQGVKERFAAHKAASDKIKAAVAALGLKQVAANPDDQAHGMTAIYLPENVKGAELLPKLASRGVVFAGGIHKAIAAKYIRFGHMGVSVLDPSRGHVEKAIKALE

Seg: seg
141-153 seg

KAASDKIKAAVAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox