PRGDB00080689 (Ptc.424)

From PRG Wiki
Jump to: navigation, search
Ptc.424
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219119846 (XM_002180639)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

AGGAGTGTAGAGAAACGAACGAAAACACAAGTACTTCCGAGAGTACTTCCGAGACCCAACGTTAGACAGGCAGGCAGGCACGCACCTTTCCTCTTCCTTTCTCCGAACACTTCCCGTTCGTACATCCATTTCCGTTTGTTCGATACTCGTACAATGAATCGTTCGTACGGAATGGCAGCTCACGGAGCGGATGGTCCGGACAGCGACGACGATGACACCATGTCGGATGTGTTCACCATGGATGGGGACTACACGTTGTCCTCCGGGATGCCGCCGCCGCCTGCCACGGAGCGCAGCCATACGCACATTCCCTTGACCGTCGAGTCGCCCTCCGCCACGCGTTCGCAAGGACTGAATCCTTACTCCCCCCGGACGGACGCCGCAGCCTACGACGTGTCGACGGATGACGGCTCCGTGTCGGGCATCGAATCCATGTCGGGCTTAATGACGACCGACGGATCCTACTTTCAAAACGATACCGTCGTGCACGACGACGAAATGTCCTTCCAAGCCAAGGTGCAAGCCGAAACGAACAAGATTCTGAGTGAGTACGACATGGAGGAAGACTTGAATCGATCCGGTGATTCCAAGCTCGGACGCTACCATAACCGTACTTCCGTGTCGGCTCCACGACAAGCCGCGCCCCCCATGACACCCACGAGCTCGATGGACGACGACAGCGACAGCGAGGCCGCACGAGCGAGGCCCGACAACCAGACGCGACACAGCAAAAAGGACCCAAGCTCCGCCGTTGGCCCCCCTCCCGTCTCTTCCAATGGAGCCAGGGGCAGCTCCGTGCGCCATTCCGTGCGATCCCTACGCAAGCAATCCAACAACAAACCCGAGGCGCCAACGAAACCGGCCGTCTACGACTTGTCGACGCCGGAAACATCCCCGACTAATCGTAAAGCGCCGGTTACGCCACAGACCAAGACCCCCCAGCGGTCCAACACCACGGCCCGGCCCCCCAACATGATCGTTGTGGGATCCTCGACTACTACCGAGTCTTCGGAAAAGAACACCCGAGCCGCCGCCGCAATCGGAGCGTCAGCCGCACCCACCAGGAAAGGGTGGTTAGGAAGTCGCTTGAGCTTCGTTATCATCGTGTTGTCGATTATTCTACTAACGGCAATTTGCGTTGCCGTGGGAGCCTTGGTCGCCGCTGGCAATCGCAATAGTGATTCTTCCAGCGCATCTTCGTCAGAAGGGGGCTCGAGCAACGAAATAGGAGCCCCGCCGGTCGATTTCCTTCCCTTCTTGCCGCCGACGACGGCGCCGATAGCTTCCGAAATCCCTTCCACCGGATCTCCGACACCGGAGCCGAGCGCGTGGAATCGTGATGTGTGTGGGATCGATGATCCCGACAAGTTGGTCTTTTTGGGTGAAGGGACCGGTGACCGCTCCTGTGAGTGGTTGAGCGGGCGTCCCAATGTCCGCGACCAATTTTGTCAACCCGGACTCGAGCCTTTTATTTATTGCCGGGAAACTTGCAACAATTGTGGACCGGCAGAGGGCGACACGACGGATGCTCCGACCGCAATGCCTCCGCCGACGAGTACACCCACATCCGAGCCAGTCATGATTACAGCCTTTCCCACCCGGGCACCAACAAGTGCTCCGACGCCGGCGCCCACCTTGGTAGCGACGATAGCACCAGTGATCATTGCCACGCCGGCTCCCATCGCAGTTGCCACCCCACCTCCTACCGGAACGTCGACGGTTGGGTCGGCTATTACGAATGCCGCACCAGCTTCCACAGCCGCAGCCCTGCAAAATCCGGCTTCAGCGCAGTCGAGAGCCTTGGCGTTCGTAGAAAACTCTAGTGCGACAGCGGCTTTGCCAGAAAGCCGCATCGTACAGCAGTTTGCTTTGGCCACGCTGGGCTTTCGAACCGGCCTAGCGGGACGGCGACTCGAGGAAGCTCGTCAATTGCAATCTTGGATGAGCGGCACGAACGAGTGTTCCTGGTCGGGTGTCACGTGTGATAGCCAATCTAGTGTCATCGGAATCAATTTAAGTGGACGAGGCTTGAGGGCATCGTTGCCTGGGGAATTGGCCATGCTGTCGAATTTGGTCACACTCGATGTGAGCGTCAACGAATTTTTTGGTACGATACCCTCGGATTTCGGTAGAATGGTTAATCTGCGTACACTACGCATGGAACAGAATGGTTTGACGGGAAGCATTCCGAATACCATGCGGAATATGCGTATTCTACGTGAGTTTTATGTGGAATGGAACGAGCTCACCGGAGATTTTCCGAACGATGTAGTTTTGGCGATGTCGAGTTTGGAGGAATTAAGTATCTACCATAACAATATCGCAGGGTCTGTTTCGGACGCGGTTTGTGCTCTGGGCCTGGACGAATTGTGGATTGACTGTCGTGAGGTCAATGTCGAAATTGGTTGCTGGACCCGGTGTTTCTTTCAATGTGGAGGGTCCACTGGTGTCGCTTGTTAA


Protein sequences

Name Description Sequence
Ptc.424 translated coding region predicted by ESTScan from UniGene Ptc.424

RSVEKRTKTQVLPRVLPRPNVRQAGRHAPFLFLSPNTSRSYIHFRLFDTRTMNRSYGMAAHGADGPDSDDDDTMSDVFTMDGDYTLSSGMPPPPATERSHTHIPLTVESPSATRSQGLNPYSPRTDAAAYDVSTDDGSVSGIESMSGLMTTDGSYFQNDTVVHDDEMSFQAKVQAETNKILSEYDMEEDLNRSGDSKLGRYHNRTSVSAPRQAAPPMTPTSSMDDDSDSEAARARPDNQTRHSKKDPSSAVGPPPVSSNGARGSSVRHSVRSLRKQSNNKPEAPTKPAVYDLSTPETSPTNRKAPVTPQTKTPQRSNTTARPPNMIVVGSSTTTESSEKNTRAAAAIGASAAPTRKGWLGSRLSFVIIVLSIILLTAICVAVGALVAAGNRNSDSSSASSSEGGSSNEIGAPPVDFLPFLPPTTAPIASEIPSTGSPTPEPSAWNRDVCGIDDPDKLVFLGEGTGDRSCEWLSGRPNVRDQFCQPGLEPFIYCRETCNNCGPAEGDTTDAPTAMPPPTSTPTSEPVMITAFPTRAPTSAPTPAPTLVATIAPVIIATPAPIAVATPPPTGTSTVGSAITNAAPASTAAALQNPASAQSRALAFVENSSATAALPESRIVQQFALATLGFRTGLAGRRLEEARQLQSWMSGTNECSWSGVTCDSQSSVIGINLSGRGLRASLPGELAMLSNLVTLDVSVNEFFGTIPSDFGRMVNLRTLRMEQNGLTGSIPNTMRNMRILREFYVEWNELTGDFPNDVVLAMSSLEELSIYHNNIAGSVSDAVCALGLENCGLTVVRSMSKLVAGPGVSFNVEGPLVSLVX

Domains

Domain Start-End Description Sequence

Seg: seg
67-81 seg

DSDDDDTMSDVFTMD

Seg: seg
215-229 seg

PPMTPTSSMDDDSDS

Seg: seg
247-258 seg

PSSAVGPPPVSS

Seg: seg
330-338 seg

SSTTTESSE

Seg: seg
343-352 seg

AAAAIGASAA

Seg: seg
363-375 seg

LSFVIIVLSIILL

Seg: seg
387-407 seg

AAGNRNSDSSSASSSEGGSSN

Seg: seg
506-525 seg

DTTDAPTAMPPPTSTPTSEP

HMMPanther: PTHR24420
525-778 FAMILY NOT NAMED,FAMILY NOT NAMED

PVMITAFPTRAPTSAPTPAPTLVATIAPVIIATPAPIAVATPPPTGTSTVGSAITNAAPASTAAALQNPASAQSRALAFVENSSATAALPESRIVQQFALATLGFRTGLAGRRLEEARQLQSWMSGTNECSWSGVTCDSQSSVIGINLSGRGLRASLPGELAMLSNLVTLDVSVNEFFGTIPSDFGRMVNLRTLRMEQNGLTGSIPNTMRNMRILREFYVEWNELTGDFPNDVVLAMSSLEELSIYHNNIAGSV

Seg: seg
529-598 seg

TAFPTRAPTSAPTPAPTLVATIAPVIIATPAPIAVATPPPTGTSTVGSAITNAAPASTAAALQNPASAQS

superfamily: SSF52058
616-785 L domain-like,LRR

SRIVQQFALATLGFRTGLAGRRLEEARQLQSWMSGTNECSWSGVTCDSQSSVIGINLSGRGLRASLPGELAMLSNLVTLDVSVNEFFGTIPSDFGRMVNLRTLRMEQNGLTGSIPNTMRNMRILREFYVEWNELTGDFPNDVVLAMSSLEELSIYHNNIAGSVSDAVCAL

HMMPfam: PF08263
IPR013210
627-662 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

LGFRTGLAGRRLEEARQLQSWMSGTNECSWSGVTCD

Gene3D: G3DSA:3.80.10.10
645-785 no description

QSWMSGTNECSWSGVTCDSQSSVIGINLSGRGLRASLPGELAMLSNLVTLDVSVNEFFGTIPSDFGRMVNLRTLRMEQNGLTGSIPNTMRNMRILREFYVEWNELTGDFPNDVVLAMSSLEELSIYHNNIAGSVSDAVCAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox