PRGDB00080692 (Ptc.515)

From PRG Wiki
Jump to: navigation, search
Ptc.515
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219117918 (XM_002179709)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

GCATATTTTGTCATCATTCGTCATTCTAGTTTGTTGTTGTTGTTGGAATTGCACCTTAACTTGGTTTGGGAATTCGTTCGAgaaaaaaagatattcaaaaaaTGCGATTTGCCGGTACTTTAACAATAGCTTGCAGCATCTTTGTTGCAGCGGCATCCCACGAATCTGATGCGCAAGTGCGTACTTTAAAGCAAAGGATCGAGGAAGAGAGGCTGGCGCGAAGTCCTCGCGGTGATAGACGACGACAGCGTATGCACGAAAGTCGACGTCTCGCTCTTGAACAAGACGTGCATATTCATCCAGATTATGACAAACGACGAAAGGCGTACGACGTAGGCTCCGGAATATTTTCCCCTCAGGACAGCACATCGAAGCCGGCTGAAATTGGTACCAGCGAAGATATGCAATTTTGGGGAAGACTGCTGCAGATCGATTCCGACATTTCGATGAGCATCGCACCCAGTCCAAGCCCCTTGGCGTCACCGATAGCCTCTCCTTCAGGTAGCTTGGCGACTCCAACCATGATGCCGCAAAAAGACCCTGCAACGGATAGTCCTATACTTAGTCCAACGCCCCTACCGACAAGATTCGCAACTAGTATGCCACAAGGAGTATCAATGACTGTACCCCCGACTCTTCTCCCAACTTCCACGCCACAAGAAGGGTCCCCGACTGTACGCCCGACTCGTCTCCCAACTTCCACGCCACAAGAAGGGTCTCCGCCTGTACGCCCCACTCCTATGCCACAAGTAGTGTCTACCACTTCAGCGCCGACTCGTCGCCCAACTTTTATGCCCACCTCGTCGCCATCAGCGGCTCCTACGCAAAGCCCATCTCGAAACCCAACCCCTGCTCCGACGCCGTCTAGGGTGGAGCAAATCGTGCTTTCCGTGGCCTTGCTTGGAGGTGCTGAGTTCCTTGATACAAATTCGTATCAGTCCAGAGCACTGTCCTGGTTAGATAGATTTTCGGATACTTCAGGATTGAGTGATGCCAGAATTGTTCAACGTTATTCGCTGGCCTGCATTTTCTATGCCACAAACGCCGTCCGTACGGTTTTCACCGATATGGCATTTGATTCATCTCAACCTCTTCCTCAGTGGCAGAATCGGGAAAATTGGCTTACGGATACAAACGAGTGCAACTGGTATGCCATAGAGCAATGCGATTCAAGCAACATGGTCGTGGAACTAGATCTGTTCAGCAATTTACTGACGGGAGAATTCCCACCTGAAATAGTTTTACTTAAAGCAAGCATCGAAGTCCTTGACCTCGGACGAAACTTATTCTTCACGGAAGGAGTAAATTTCAACACAGTCCTTGGACAACTGACGAAACTAAAATTCCTTTTGTTTGATCAAACGAATATGATCAATTTAAATGGAATCCCGACTGAGATTGGAAATTTGAAAAGCTTGGAGTCCTTCAATTGCGTCGCAACGAGATATGGAGGCGCTTTAAACGGCGATGCATTTCAGCCGGACCAGATCAATTGGACGATATTGGAAATAGAAGAGAACGCTTTCAACTCAGCCATTCCTTCCGCAATCGCCAACCTTCCTGCCTTGGAACAGTTTTTTGGAAGAGACTGCGGCTTGCAAGGCACACTGGAACCTCTCCGGAATATGGACAATGCAGTTGTTCTGTGGGTTGATATGAATCCTCTTTTAGGGGGCCCAATTCCAACTGAATTTGGTAATTTTCAGCAATTGCGGAGTTTATCTCTAACAGAGTGCGATTTCACCGGTACATTTCCAAGTGAGCTGGGCACTGTGAGCTCTTTGTCGCAATTGTTTTTGTTTCGAAACAGACTTGATGGAACGATACCAAGCGAACTGGCGGAGCTTCAAGATCTATCAATCCTGGAAATTTGGGAAAACAATTTCACTGGCATCATCCCTCCTCTTGTTTGCCAGTTGACCTTTTCGGACCTAACTCGTTTGATTGCCGATTGTGAAAACTGCCCAACAGCAGGTTTCTGCTGTGATTCGTGTGTAGGCTAATTTTTATTTAAAGAAGATGTGGTTGTTACGTGGACTTCGCCTGAAGTAAATCTGACAAACCCATTCATCTCTTTTCGGCAGTTTTTGTCCTAAAAGCTGTCGATCAATGTAAGAGATATCGATCCAAATCGAAGCCATTTGCGTTCGCTATATATCTCGCTTCTCCTTCCGTTGTGGAGCATACAAATCGAGGCTCAACCATTTGGGCATGATCATAGGGAGATCGTGCCGGCTGCTCAAGGATGGCATTCATTTCTTTCAAATGAGACGTGGCCATTACCAAGGACAAAGTACCCAGCGCATTTGAGCTTTCCTCGGCATCAAAGCCAGATAAAGCCTGGTGAAGACTTTCACAATTTAACCCCAGCAAACTTACGAATATACTTAACAGCCGCTCCTGCGGAAAGGACCTCAGTCGCACGTTGTTGCACTGTTGACTGGACGAGCCAAATGCCAAGTCTTCAGCGTTAGCATTTTCAGTAGTCGCTTTCTTACGACGGCGTCCATTTCGCTCAACACTGAACACGTGTCTGTCACGATCAGGGCGATTG


Protein sequences

Name Description Sequence
Ptc.515 translated coding region predicted by ESTScan from UniGene Ptc.515

MRFAGTLTIACSIFVAAASHESDAQVRTLKQRIEEERLARSPRGDRRRQRMHESRRLALEQDVHIHPDYDKRRKAYDVGSGIFSPQDSTSKPAEIGTSEDMQFWGRLLQIDSDISMSIAPSPSPLASPIASPSGSLATPTMMPQKDPATDSPILSPTPLPTRFATSMPQGVSMTVPPTLLPTSTPQEGSPTVRPTRLPTSTPQEGSPPVRPTPMPQVVSTTSAPTRRPTFMPTSSPSAAPTQSPSRNPTPAPTPSRVEQIVLSVALLGGAEFLDTNSYQSRALSWLDRFSDTSGLSDARIVQRYSLACIFYATNAVRTVFTDMAFDSSQPLPQWQNRENWLTDTNECNWYAIEQCDSSNMVVELDLFSNLLTGEFPPEIVLLKASIEVLDLGRNLFFTEGVNFNTVLGQLTKLKFLLFDQTNMINLNGIPTEIGNLKSLESFNCVATRYGGALNGDAFQPDQINWTILEIEENAFNSAIPSAIANLPALEQFFGRDCGLQGTLEPLRNMDNAVVLWVDMNPLLGGPIPTEFGNFQQLRSLSLTECDFTGTFPSELGTVSSLSQLFLFRNRLDGTIPSELAELQDLSILEIWENNFTGIIPPLVCQLTFSDLTRLIADCENCPTAGFCCDSCVGXFLFKEDVVVTWTSPEVNLTNPFISFRQFLSXKLSINVRDIDPNRSHLRSLYISLLLPLWSIQIEAQPFGHDHREIVPAAQGWHSFLSNETWPLPRTKYPAHLSFPRHQSQIKPGEDFHNLTPANLRIYLTAAPAERTSVAVVALLTGRAKCQVFSVSIFSSRFLTTASISLNTEHVSVTIRAIX

Domains

Domain Start-End Description Sequence

Seg: seg
110-137 seg

IDSDISMSIAPSPSPLASPIASPSGSLA

Seg: seg
171-185 seg

VSMTVPPTLLPTSTP

Seg: seg
232-245 seg

PTSSPSAAPTQSPS

superfamily: SSF52058
312-606 L domain-like,LRR

ATNAVRTVFTDMAFDSSQPLPQWQNRENWLTDTNECNWYAIEQCDSSNMVVELDLFSNLLTGEFPPEIVLLKASIEVLDLGRNLFFTEGVNFNTVLGQLTKLKFLLFDQTNMINLNGIPTEIGNLKSLESFNCVATRYGGALNGDAFQPDQINWTILEIEENAFNSAIPSAIANLPALEQFFGRDCGLQGTLEPLRNMDNAVVLWVDMNPLLGGPIPTEFGNFQQLRSLSLTECDFTGTFPSELGTVSSLSQLFLFRNRLDGTIPSELAELQDLSILEIWENNFTGIIPPLVCQL

Gene3D: G3DSA:3.80.10.10
322-613 no description

DMAFDSSQPLPQWQNRENWLTDTNECNWYAIEQCDSSNMVVELDLFSNLLTGEFPPEIVLLKASIEVLDLGRNLFFTEGVNFNTVLGQLTKLKFLLFDQTNMINLNGIPTEIGNLKSLESFNCVATRYGGALNGDAFQPDQINWTILEIEENAFNSAIPSAIANLPALEQFFGRDCGLQGTLEPLRNMDNAVVLWVDMNPLLGGPIPTEFGNFQQLRSLSLTECDFTGTFPSELGTVSSLSQLFLFRNRLDGTIPSELAELQDLSILEIWENNFTGIIPPLVCQLTFSDLTR

HMMPanther: PTHR24420:SF462
337-607 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RENWLTDTNECNWYAIEQCDSSNMVVELDLFSNLLTGEFPPEIVLLKASIEVLDLGRNLFFTEGVNFNTVLGQLTKLKFLLFDQTNMINLNGIPTEIGNLKSLESFNCVATRYGGALNGDAFQPDQINWTILEIEENAFNSAIPSAIANLPALEQFFGRDCGLQGTLEPLRNMDNAVVLWVDMNPLLGGPIPTEFGNFQQLRSLSLTECDFTGTFPSELGTVSSLSQLFLFRNRLDGTIPSELAELQDLSILEIWENNFTGIIPPLVCQLT

HMMPanther: PTHR24420
337-607 FAMILY NOT NAMED,FAMILY NOT NAMED

RENWLTDTNECNWYAIEQCDSSNMVVELDLFSNLLTGEFPPEIVLLKASIEVLDLGRNLFFTEGVNFNTVLGQLTKLKFLLFDQTNMINLNGIPTEIGNLKSLESFNCVATRYGGALNGDAFQPDQINWTILEIEENAFNSAIPSAIANLPALEQFFGRDCGLQGTLEPLRNMDNAVVLWVDMNPLLGGPIPTEFGNFQQLRSLSLTECDFTGTFPSELGTVSSLSQLFLFRNRLDGTIPSELAELQDLSILEIWENNFTGIIPPLVCQLT

Seg: seg
679-694 seg

SHLRSLYISLLLPLWS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox