PRGDB00080694 (Ptc.669)

From PRG Wiki
Jump to: navigation, search
Ptc.669
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 144654082 (CT892114)
Gene Class Unknown
Domain Type
Gene Species Dimocarpus longan

Comment?

CT892114 Phaeodactylum tricornutum low decadienal treated (0.5 ug

DNA Sequence

GACCAAACAGTCTTTGACCGTGAGAGCGGGATGCGGCCTGCACTGTGGCAACCAACAATGGTCCAAAGCGGAACTTCCACCTCGCTTTCCGCGGTAGTACCCTCGCCACACACCATCATGGCGAGCCATAGTGCCACCAGTGTCCCGACGTGGGTTGCGGTGTGTGGGAATTTGGCTCCAGCAGCCGCCATTGTTGTTTTCCTGGCGCCCTGGCCGACCATTGCCAACATTCGTCGGGATCGGACCGTGGGCACGCTGCCGCTCCTGCCGTATTCTTCCATGATTGCGTCAGCCTTTCTCTGGGTTGTCTACGGACTCTTAAAGAACGAATCCAAGATATGGTCTTCCAACGGCGTGGGACTCGTGCTCGGTTTGTACTACTTTGGGAATTTTGTCAAGCACGCGCCCAAAGCCGCGCCTACACTGCCGGGTTCCGTCAAGCAGCACTTGCAAGCCATGGGAACCGTTATCTTGGGCACGCTGATGCTTGCATTGTCGCCCATGCAATCCCCCGTCAATATCATCGGTACCCTGGGAGTCATATTCTGTGTCGCCATGTTTGCGAGTCCGTTGGCCGCCCTCAAGACTGTGCTGGAAACCAAGTCGGCGCAGTCCATTCCGTTGCCCTTTACGTTGGCATCCACCGCTAACTGTCTGCTCTGGAGCATTACCGGGATCTTTGATATGAAAGATCCCAACGTCATTGTTCCGAATTTGTTGGGATTGGTCTTTTCTCTCGCACAGGTCGTCCTCAAGATAGTCTATGGTGACGGACCCAAAGGCAAGCTGGGACCCTTGCCGCTCTGAACCGGTTGCGCAGGGTCGTTGCCATCATCGTCTCATCCTACACATACTAATCCGGCTGACAATCAACACGCATGGCAAAAGCCTTTCTAATTGAACCGAACCAAAAACCCCTTCCCAATTCTA


Protein sequences

Name Description Sequence
Ptc.669 translated coding region predicted by ESTScan from UniGene Ptc.669

DQTVFDRESGMRPALWQPTMVQSGTSTSLSAVVPSPHTIMASHSATSVPTWVAVCGNLAPAAAIVVFLAPWPTIANIRRDRTVGTLPLLPYSSMIASAFLWVVYGLLKNESKIWSSNGVGLVLGLYYFGNFVKHAPKAAPTLPGSVKQHLQAMGTVILGTLMLALSPMQSPVNIIGTLGVIFCVAMFASPLAALKTVLETKSAQSIPLPFTLASTANCLLWSITGIFDMKDPNVIVPNLLGLVFSLAQVVLKIVYGDGPKGKLGPLPLXTGCAGSLPSSSHPTHTNPADNQHAWQKPF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791:SF6
50-255 NODULIN MTN3-RELATED,NODULIN MTN3-RELATED

TWVAVCGNLAPAAAIVVFLAPWPTIANIRRDRTVGTLPLLPYSSMIASAFLWVVYGLLKNESKIWSSNGVGLVLGLYYFGNFVKHAPKAAPTLPGSVKQHLQAMGTVILGTLMLALSPMQSPVNIIGTLGVIFCVAMFASPLAALKTVLETKSAQSIPLPFTLASTANCLLWSITGIFDMKDPNVIVPNLLGLVFSLAQVVLKIVY

HMMPanther: PTHR10791
IPR004316
50-255 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

TWVAVCGNLAPAAAIVVFLAPWPTIANIRRDRTVGTLPLLPYSSMIASAFLWVVYGLLKNESKIWSSNGVGLVLGLYYFGNFVKHAPKAAPTLPGSVKQHLQAMGTVILGTLMLALSPMQSPVNIIGTLGVIFCVAMFASPLAALKTVLETKSAQSIPLPFTLASTANCLLWSITGIFDMKDPNVIVPNLLGLVFSLAQVVLKIVY

HMMPfam: PF03083
IPR004316
57-137 MtN3_slv
RAG1-activating protein-1-related

NLAPAAAIVVFLAPWPTIANIRRDRTVGTLPLLPYSSMIASAFLWVVYGLLKNESKIWSSNGVGLVLGLYYFGNFVKHAPK

Seg: seg
115-131 seg

SSNGVGLVLGLYYFGNF

HMMPfam: PF03083
IPR004316
174-255 MtN3_slv
RAG1-activating protein-1-related

IIGTLGVIFCVAMFASPLAALKTVLETKSAQSIPLPFTLASTANCLLWSITGIFDMKDPNVIVPNLLGLVFSLAQVVLKIVY

Seg: seg
258-269 seg

GPKGKLGPLPLX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox