PRGDB00080696 (Ptc.773)

From PRG Wiki
Jump to: navigation, search
Ptc.773
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186993122 (CU704842)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Dimocarpus longan

Comment?

CU704842 Phaeodactylum tricornutum 48 hour dark-adapted cells exposed to blue light for 1 hour Phaeodactylum tricornutum cDNA clone KS0ARA17YB02 5', mRNA sequence

DNA Sequence

TAGAAAAGCCAGGCTCCAATCTCGGTGAAGGAACGTATGGTGTGGTATACAAGGCCCTTGATCGTCAGACGGACGAGATTGTTGCCCTCAAGCGTATCCGATTGGAAGTCGAAGACGAAGGCATTCCCTCGACGGCTCTCCGTGAAATATCTCTGTTGCGGGAACTTTCGCACCCGAACATTGTCGACTTGAAGGACTGTGTTCAGGAAGATGGCAAGCTTTACCTCGTTTTCGAATTCCTTGACAAGGATTTGAAAAAGTACATGGAAAGCTGCACCGGACTACTCTCGAAGGCTTTGATCAAGTCGTATACGTTCCAGTGTCTCCGGGGTTTGGCGTTCTGTCATGCGCGTGGTGTCATGCACCGTGACCTGAAGCCACAGAATCTCTTGGTTACAAGGGACGGGTGTCTTAAGATAGCGGACTTTGGTCTAGCCCGGGCCTTCTGCCCTCCGATCCGTCCTTTGACACACGAAGTTGTCACTCTGTGGTACCGCCCTCCCGAGATCTTGCTTGGTTCGCAGACGTATGCTCCTCCGATGGACGTTTGGGCTATCGGAGCGATCCTCGTTGAGATGATCACCAAGCGCCCTTTGTTCCCGGGAGATTCGGAGATTGACCAGCTGTACAAGATTTTCCGTCAGTTGGGAACTCCACGGGAAGATGTTTGGCCGGGCGTGACCCAACTACAGGATTGGAATACGACTTTCCCCGTTTGGTTCAAGTCTCCCTTCTCGCAGAATGTCTTGGAAAAATTTGGAGCCAGCGGGATGGGAGCTGTTGGAAACCTTTCTTGGCGACGAACCCCAGGGATCTAATCACGCCAAAAGATCTCTTCGTCCCGCTTATTTTGATGGCCTTGATAAGGAAAAATTCGAATATGAGGGCGAGCGAAAACGATTTCGTGGCCCCGCTTcccccccaccccAAATTGGTTCCCAGGTCCACCAAGTGCGGCGAAAAAGACGGAAAAAGAGGGCATTTCCCCGGGCCCCCTTTCATTGGGGGGTTAAACTTTACCATATTCAAAGATTCTCCCCTTTTAATTAAAACAAAAAACCCCCTTCTGCAAAACCTATTCATAAAAAGCCCAAAAGaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaccccatcttttttttttgttaaaaaagttttgcgctattttttaataaaaagtgactttgtctttttttatatttattttttgtttttGATTTAGACAAAAAAGACGGCGGGCCACCCCTCTCCACT


Protein sequences

Name Description Sequence
Ptc.773 translated coding region predicted by ESTScan from UniGene Ptc.773

XEKPGSNLGEGTYGVVYKALDRQTDEIVALKRIRLEVEDEGIPSTALREISLLRELSHPNIVDLKDCVQEDGKLYLVFEFLDKDLKKYMESCTGLLSKALIKSYTFQCLRGLAFCHARGVMHRDLKPQNLLVTRDGCLKIADFGLARAFCPPIRPLTHEVVTLWYRPPEILLGSQTYAPPMDVWAIGAILVEMITKRPLFPGDSEIDQLYKIFRQLGTPREDVWPGVTQLQDWNTTFPVWFKSPFSQNVLEKFGASGMGAVGNLSWRRTPGI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
2-272 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EKPGSNLGEGTYGVVYKALDRQTDEIVALKRIRLEVEDEGIPSTALREISLLRELSHPNIVDLKDCVQEDGKLYLVFEFLDKDLKKYMESCTGLLSKALIKSYTFQCLRGLAFCHARGVMHRDLKPQNLLVTRDGCLKIADFGLARAFCPPIRPLTHEVVTLWYRPPEILLGSQTYAPPMDVWAIGAILVEMITKRPLFPGDSEIDQLYKIFRQLGTPREDVWPGVTQLQDWNTTFPVWFKSPFSQNVLEKFGASGMGAVGNLSWRRTPGI

HMMSmart: SM00219
IPR020635
2-253 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EKPGSNLGEGTYGVVYKALDRQTDEIVALKRIRLEVEDEGIPSTALREISLLRELSHPNIVDLKDCVQEDGKLYLVFEFLDKDLKKYMESCTGLLSKALIKSYTFQCLRGLAFCHARGVMHRDLKPQNLLVTRDGCLKIADFGLARAFCPPIRPLTHEVVTLWYRPPEILLGSQTYAPPMDVWAIGAILVEMITKRPLFPGDSEIDQLYKIFRQLGTPREDVWPGVTQLQDWNTTFPVWFKSPFSQNVLEKF

HMMSmart: SM00220
IPR002290
2-272 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

EKPGSNLGEGTYGVVYKALDRQTDEIVALKRIRLEVEDEGIPSTALREISLLRELSHPNIVDLKDCVQEDGKLYLVFEFLDKDLKKYMESCTGLLSKALIKSYTFQCLRGLAFCHARGVMHRDLKPQNLLVTRDGCLKIADFGLARAFCPPIRPLTHEVVTLWYRPPEILLGSQTYAPPMDVWAIGAILVEMITKRPLFPGDSEIDQLYKIFRQLGTPREDVWPGVTQLQDWNTTFPVWFKSPFSQNVLEKFGASGMGAVGNLSWRRTPGI

Gene3D: G3DSA:3.30.200.20
5-97 no description

GSNLGEGTYGVVYKALDRQTDEIVALKRIRLEVEDEGIPSTALREISLLRELSHPNIVDLKDCVQEDGKLYLVFEFLDKDLKKYMESCTGLLS

HMMPfam: PF00069
IPR017442
6-227 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SNLGEGTYGVVYKALDRQTDEIVALKRIRLEVEDEGIPSTALREISLLRELSHPNIVDLKDCVQEDGKLYLVFEFLDKDLKKYMESCTGLLSKALIKSYTFQCLRGLAFCHARGVMHRDLKPQNLLVTRDGCLKIADFGLARAFCPPIRPLTHEVVTLWYRPPEILLGSQTYAPPMDVWAIGAILVEMITKRPLFPGDSEIDQLYKIFRQLGTPREDVWPGV

superfamily: SSF56112
IPR011009
8-241 Protein kinase-like (PK-like)
Protein kinase-like domain

LGEGTYGVVYKALDRQTDEIVALKRIRLEVEDEGIPSTALREISLLRELSHPNIVDLKDCVQEDGKLYLVFEFLDKDLKKYMESCTGLLSKALIKSYTFQCLRGLAFCHARGVMHRDLKPQNLLVTRDGCLKIADFGLARAFCPPIRPLTHEVVTLWYRPPEILLGSQTYAPPMDVWAIGAILVEMITKRPLFPGDSEIDQLYKIFRQLGTPREDVWPGVTQLQDWNTTFPVWF

PatternScan: PS00107
IPR017441
8-31 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGTYGVVYKALDRQTDEIVALK

HMMPanther: PTHR24056
8-247 FAMILY NOT NAMED,CELL DIVISION PROTEIN KINASE

LGEGTYGVVYKALDRQTDEIVALKRIRLEVEDEGIPSTALREISLLRELSHPNIVDLKDCVQEDGKLYLVFEFLDKDLKKYMESCTGLLSKALIKSYTFQCLRGLAFCHARGVMHRDLKPQNLLVTRDGCLKIADFGLARAFCPPIRPLTHEVVTLWYRPPEILLGSQTYAPPMDVWAIGAILVEMITKRPLFPGDSEIDQLYKIFRQLGTPREDVWPGVTQLQDWNTTFPVWFKSPFSQ

Coil: coil
20-41 coiled-coil

LDRQTDEIVALKRIRLEVEDEG

Gene3D: G3DSA:1.10.510.10
98-245 no description

KALIKSYTFQCLRGLAFCHARGVMHRDLKPQNLLVTRDGCLKIADFGLARAFCPPIRPLTHEVVTLWYRPPEILLGSQTYAPPMDVWAIGAILVEMITKRPLFPGDSEIDQLYKIFRQLGTPREDVWPGVTQLQDWNTTFPVWFKSPF

PatternScan: PS00108
IPR008271
120-132 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VMHRDLKPQNLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox