PRGDB00080697 (Ptc.1044)

From PRG Wiki
Jump to: navigation, search
Ptc.1044
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219128571 (XM_002184447)
Gene Class N
Domain Type NBS
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

TTGATTGTGCACTACTCTCGTAGTAAAATCAATTCAGTCTACATTTGACACAGAGCGCTGGCAACTATTGGTTTGAGTCTACAGACTGACGCAAACGAAAACCGAGATGAGTTTGCAGCCACGAAGGCAACGGCGACGAGGATGTCGCCAGATTTCGTTGTTGTGCTTATACACGTTGCTGATTGCGATCGGATTGTTGGCCCATTCCGTGCACGGTCAACGTGCGGCTGTGAACTTGAGCCAGAAGATTCAGAACCGATTCGCCAAATCCGCAGGACGTGGAAATATCGTTGAAGACAAAAGTTCCATTGGAAAAACGTCTCGTTGGTTCCATGTTGCGGGCCTTTGGGAACCGGAGATTCCAGTAAACTCGCCAAACTTGATCGCTACTGTAGTGTTGGCTGCAATGATTCTGGCTGCTCTGGTCGTCTATTTGCCTCAACCGACAAAAAAAGATTTGCGAGTCGGAGTCCGGGACGATGAACTTAAGATTGAGGGTGGCAATGTGGTAGACACTGAACCGATTGATTTGGCCTTTGAAGGATTAACGTTAGAGTTGGAAACCAAGTCGGGTGAGGTCCGAACCATACTCGACGGCGTCCGTGGTCGAGCCCAGCCTGGCCGTATGCTGGCAGTCATGGGACCATCAGGTGCGGGAAAGTCCACGCTGATACACGCCTTAGTTGGGCGAGTCAAAGACAATACGAAATTGTCATTGTACGGTCGCAGGTACATCAACGGCGAACCCGTGTCTGGGGATTCACTCTTGCCGGCTGCTTTCATCGAACAAGACGTCAACTTCTTCCCGCACATGACGGTCCGTGAAACTCTCCACTTTCGTGTGGAATTGAAACTGGGAAGTTTACTGAGTAAGCATGCTCGAGACAAAATGGTGGACGGATTGATGGATCAATTAGGTTTGACGAAAGCTGCCGATACAGTTGTCGGAGACGCAAAGGTCCGCGGCATCTCGGGTGGAGAGCGCAAGCGTCTTTCCATCGCAGTGGAAATGATCTCAAGTCCTTCCGTTATTGTTCTAGACGAGCCCACAAGCGGCTTAGATAGCACTGCAGCTACTTCTTTGGTACAGACGCTTCGAGATTTAGCCGATTCCGGGAAGACAGTGATTGCTGTTATTCATCAGCCAAGTCAGCACGTCTTTGCAAAATTTGATGATCTGCTACTCGTTTCTGAAGGAAAGCTGATGTACTATGGCGAGCTACATGGGGTAAGATCCTATATGGAATCTTACGGACACCCAGCAACCGCAGAAATGGGAACCGCAGAGCATATTCTAGATTGCATTTCACGGCTTCCAATTGAAGAGGAAACCAAAGATGAGATGAATTCACGTATGGAGCGACTTATTTACAAAGCAAACTCGAACCCATTGGATTTAGGTAAGATGGCAACAGACGACAACGGGACGACAGAGTTTACCATGGTTTCCCGCGGTGGCCCGAAAGCTGGCATAATTACTCAATTTCGAACACTTTTCAAACGCTCCTTTCGAGAGGTAATTCGTGGCAAAACAACGCTCATCTTAAAGACTGTCCAACAAATCTCGCTAGGAGTCATTTACGGCGGAATCTATTCGCTGGGCACAAACCAGGCCTCGATACAGGATCGCTTTGGTCTGCTTTCCTTGATTGCCATTGGATCAGCGAACATGGCTGTTGCGTCTACAATTCGATCCTTTCCTCGGGAAAAGGCTATAGTTTCGAACGAAATCGCTTCAAAGATGTACCGCACTCTTCCATACTTCATTGGTAAAGCACTTTCGGAGCTGCCATTAGTGGCTGTTTTTAACGGTATTTTTGGAACCATCGTGTACCATTTGACGGGTCTCAGTCGTATGAAAGGAAAATTCCGACGTTTTCTCGGCTTATTGACTACGCACGGTTTGGCATCCGAAGCAGTGGGTCTTGTTATCGGGGCCGTCAGTCCGAGTTCCGATGTTGCATTGGCTATCTTTCCTGCTGTTCTTGTATTGAACATTATCTTTGATGGCAAGAACATCTCCGAAGAGAACACACCGAGATTGCTGAGATGGATTCCTAAGATCGGCTTGATTCGATGGGGGTTTGAAGGGCTATGTGTCAATGAATTCGACCAATTGACTTTTGATACGAAAGGACCACGTCGAGGACCAGTCGCCAAGTTTGGGTCGGAAGCGTTGGATCGTTTTGGTTTGGGGACGAATACACTCGGCGATATCGTGAAAGCACAACTCTCCATCACGGTTGTTTCCTGGGCTCTTAGCTACATTGGTTTAACGTTGACGGGTCAAAAATATCTCAAGATGCAATCATTTAAAAGCGATTCGGATTGACTGTGAAAGGAAAAAAGAGTCTAAAAATTTGAAAGGTAGGAGGTTTACGTAAATGAAGGCTTTTGATTGCGTGAATGATACTCTGTTGTACTGAGACACCCAAATATTCGGGAGAACATAAATACTGTCAGTGACGATTCTTTTTATT


Protein sequences

Name Description Sequence
Ptc.1044 translated coding region predicted by ESTScan from UniGene Ptc.1044

LIVHYSRSKINSVYIXHRALATIGLSLQTDANENRDEFAATKATATRMSPDFVVVLIHVADCDRIVGPFRDGQRAAVNLSQKIQNRFAKSAGRGNIVEDKSSIGKTSRWFHVAGLWEPEIPVNSPNLIATVVLAAMILAALVVYLPQPTKKDLRVGVRDDELKIEGGNVVDTEPIDLAFEGLTLELETKSGEVRTILDGVRGRAQPGRMLAVMGPSGAGKSTLIHALVGRVKDNTKLSLYGRRYINGEPVSGDSLLPAAFIEQDVNFFPHMTVRETLHFRVELKLGSLLSKHARDKMVDGLMDQLGLTKAADTVVGDAKVRGISGGERKRLSIAVEMISSPSVIVLDEPTSGLDSTAATSLVQTLRDLADSGKTVIAVIHQPSQHVFAKFDDLLLVSEGKLMYYGELHGVRSYMESYGHPATAEMGTAEHILDCISRLPIEEETKDEMNSRMERLIYKANSNPLDLGKMATDDNGTTEFTMVSRGGPKAGIITQFRTLFKRSFREVIRGKTTLILKTVQQISLGVIYGGIYSLGTNQASIQDRFGLLSLIAIGSANMAVASTIRSFPREKAIVSNEIASKMYRTLPYFIGKALSELPLVAVFNGIFGTIVYHLTGLSRMKGKFRRFLGLLTTHGLASEAVGLVIGAVSPSSDVALAIFPAVLVLNIIFDGKNISEENTPRLLRWIPKIGLIRWGFEGLCVNEFDQLTFDTKGPRRGPVAKFGSEALDRFGLGTNTLGDIVKAQLSITVVSWALSYIGLTLTGQKYLKMQSFKSDSD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF28
13-774 ABC TRANSPORTER (PLANT),ABC TRANSPORTER (PLANT)

VYIXHRALATIGLSLQTDANENRDEFAATKATATRMSPDFVVVLIHVADCDRIVGPFRDGQRAAVNLSQKIQNRFAKSAGRGNIVEDKSSIGKTSRWFHVAGLWEPEIPVNSPNLIATVVLAAMILAALVVYLPQPTKKDLRVGVRDDELKIEGGNVVDTEPIDLAFEGLTLELETKSGEVRTILDGVRGRAQPGRMLAVMGPSGAGKSTLIHALVGRVKDNTKLSLYGRRYINGEPVSGDSLLPAAFIEQDVNFFPHMTVRETLHFRVELKLGSLLSKHARDKMVDGLMDQLGLTKAADTVVGDAKVRGISGGERKRLSIAVEMISSPSVIVLDEPTSGLDSTAATSLVQTLRDLADSGKTVIAVIHQPSQHVFAKFDDLLLVSEGKLMYYGELHGVRSYMESYGHPATAEMGTAEHILDCISRLPIEEETKDEMNSRMERLIYKANSNPLDLGKMATDDNGTTEFTMVSRGGPKAGIITQFRTLFKRSFREVIRGKTTLILKTVQQISLGVIYGGIYSLGTNQASIQDRFGLLSLIAIGSANMAVASTIRSFPREKAIVSNEIASKMYRTLPYFIGKALSELPLVAVFNGIFGTIVYHLTGLSRMKGKFRRFLGLLTTHGLASEAVGLVIGAVSPSSDVALAIFPAVLVLNIIFDGKNISEENTPRLLRWIPKIGLIRWGFEGLCVNEFDQLTFDTKGPRRGPVAKFGSEALDRFGLGTNTLGDIVKAQLSITVVSWALSYIGLTLTGQKYLKMQSFKSD

HMMPanther: PTHR19241
13-774 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

VYIXHRALATIGLSLQTDANENRDEFAATKATATRMSPDFVVVLIHVADCDRIVGPFRDGQRAAVNLSQKIQNRFAKSAGRGNIVEDKSSIGKTSRWFHVAGLWEPEIPVNSPNLIATVVLAAMILAALVVYLPQPTKKDLRVGVRDDELKIEGGNVVDTEPIDLAFEGLTLELETKSGEVRTILDGVRGRAQPGRMLAVMGPSGAGKSTLIHALVGRVKDNTKLSLYGRRYINGEPVSGDSLLPAAFIEQDVNFFPHMTVRETLHFRVELKLGSLLSKHARDKMVDGLMDQLGLTKAADTVVGDAKVRGISGGERKRLSIAVEMISSPSVIVLDEPTSGLDSTAATSLVQTLRDLADSGKTVIAVIHQPSQHVFAKFDDLLLVSEGKLMYYGELHGVRSYMESYGHPATAEMGTAEHILDCISRLPIEEETKDEMNSRMERLIYKANSNPLDLGKMATDDNGTTEFTMVSRGGPKAGIITQFRTLFKRSFREVIRGKTTLILKTVQQISLGVIYGGIYSLGTNQASIQDRFGLLSLIAIGSANMAVASTIRSFPREKAIVSNEIASKMYRTLPYFIGKALSELPLVAVFNGIFGTIVYHLTGLSRMKGKFRRFLGLLTTHGLASEAVGLVIGAVSPSSDVALAIFPAVLVLNIIFDGKNISEENTPRLLRWIPKIGLIRWGFEGLCVNEFDQLTFDTKGPRRGPVAKFGSEALDRFGLGTNTLGDIVKAQLSITVVSWALSYIGLTLTGQKYLKMQSFKSD

Seg: seg
127-145 seg

LIATVVLAAMILAALVVYL

Gene3D: G3DSA:3.40.50.300
177-411 no description

LAFEGLTLELETKSGEVRTILDGVRGRAQPGRMLAVMGPSGAGKSTLIHALVGRVKDNTKLSLYGRRYINGEPVSGDSLLPAAFIEQDVNFFPHMTVRETLHFRVELKLGSLLSKHARDKMVDGLMDQLGLTKAADTVVGDAKVRGISGGERKRLSIAVEMISSPSVIVLDEPTSGLDSTAATSLVQTLRDLADSGKTVIAVIHQPSQHVFAKFDDLLLVSEGKLMYYGELHGVR

ProfileScan: PS50893
IPR003439
182-423 ABC_TRANSPORTER_2
ABC transporter-like

LTLELETKSGEVRTILDGVRGRAQPGRMLAVMGPSGAGKSTLIHALVGRVKDNTKLSLYGRRYINGEPVSGDSLLPAAFIEQDVNFFPHMTVRETLHFRVELKLGSLLSKHARDKMVDGLMDQLGLTKAADTVVGDAKVRGISGGERKRLSIAVEMISSPSVIVLDEPTSGLDSTAATSLVQTLRDLADSGKTVIAVIHQPSQHVFAKFDDLLLVSEGKLMYYGELHGVRSYMESYGHPATA

superfamily: SSF52540
184-405 P-loop containing nucleoside triphosphate hydrolases

LELETKSGEVRTILDGVRGRAQPGRMLAVMGPSGAGKSTLIHALVGRVKDNTKLSLYGRRYINGEPVSGDSLLPAAFIEQDVNFFPHMTVRETLHFRVELKLGSLLSKHARDKMVDGLMDQLGLTKAADTVVGDAKVRGISGGERKRLSIAVEMISSPSVIVLDEPTSGLDSTAATSLVQTLRDLADSGKTVIAVIHQPSQHVFAKFDDLLLVSEGKLMYYG

HMMSmart: SM00382
IPR003593
206-400 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGRMLAVMGPSGAGKSTLIHALVGRVKDNTKLSLYGRRYINGEPVSGDSLLPAAFIEQDVNFFPHMTVRETLHFRVELKLGSLLSKHARDKMVDGLMDQLGLTKAADTVVGDAKVRGISGGERKRLSIAVEMISSPSVIVLDEPTSGLDSTAATSLVQTLRDLADSGKTVIAVIHQPSQHVFAKFDDLLLVSEGK

HMMPfam: PF00005
IPR003439
221-351 ABC_tran
ABC transporter-like

STLIHALVGRVKDNTKLSLYGRRYINGEPVSGDSLLPAAFIEQDVNFFPHMTVRETLHFRVELKLGSLLSKHARDKMVDGLMDQLGLTKAADTVVGDAKVRGISGGERKRLSIAVEMISSPSVIVLDEPTS

PatternScan: PS00211
IPR017871
323-337 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGERKRLSIAVEM

HMMPfam: PF01061
IPR013525
493-703 ABC2_membrane
ABC-2 type transporter

TQFRTLFKRSFREVIRGKTTLILKTVQQISLGVIYGGIYSLGTNQASIQDRFGLLSLIAIGSANMAVASTIRSFPREKAIVSNEIASKMYRTLPYFIGKALSELPLVAVFNGIFGTIVYHLTGLSRMKGKFRRFLGLLTTHGLASEAVGLVIGAVSPSSDVALAIFPAVLVLNIIFDGKNISEENTPRLLRWIPKIGLIRWGFEGLCVNEF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox