PRGDB00080698 (Ptc.1317)

From PRG Wiki
Jump to: navigation, search
Ptc.1317
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 144659995 (CT908397)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Dimocarpus longan

Comment?

CT908397 Phaeodactylum tricornutum nitrate starved (50 uM for 3 days in chemostat culture) Phaeodactylum tricornutum cDNA 5', mRNA sequence

DNA Sequence

CAGTCAGTGTCTCTGGCTTGGGGCAACCTTCGTGGTTCGCTTCCGACGGAGATTGTCGAAATGAAGCACTTGGTTAACATCGAATTACACTACAACAAGTTCACTGGGGAAGTTCCACTCGAATGGTGGCGCGCTCGCAATTTGGTCCGGATCAACCTGGCCGAGAACAGCATCGAAGGTGAAATTCCACCAGAAATAAAGAACCTCGAAGATGTGAAGGGGCTGTTCCTGTCTGAGAACTTGTTCCGAGGGACATTGCCTGACGAGATAGGGGATCTCAGTAGTGTTTCGTTCTTCCGATTGTCCCGTAATTTATTGGAAGGAACCCTGCCGTCCACTGTTGGTCAGATGAGCCAGCTTGGGGAGATTTGGTTACATCGCAACTATCTGACGGGAGCGTTACCAACCGAGATTGGGAATCTTTCCAAATTGGCGCGTCTTCGATTGCAGTTCAACAGCTTTCGTGGTGAACTTCCCGGACAGCTGTATGGACTTACATCGCTGGATCGCTTAGATTTGTACAACTGCAACTTCACGGGCACAATCAGTCCGGCTATTGGCAACCTTACAAACATGAGTTTCCTACGGCTGCACGATAACAACTTTTTTGGAGGCATCCCCACGGAGCTTGGTCAGCTGTCCGTCCTGTCATCGTTGATGTTGCAAGGAAACCAGTTGACTGGCACAATTCCAGACAGCATCTGCGAAGTCCGGCAAAACTGGGTTCCGTTTGAAGAATTGGAAGCGGATTGTGCGGGGTCATCGAGCGGGGGACCGGAAGTGACGTGCCCCGACTTGTGTTGCACTTCCTGCTGTGAACGACAAAATGTTTGTACCCCCACACCTACGCGCATGATCTAACAAGCGAACATTGTTGGTGGATGTATCACCGAATCCCCTGTGAACTGTTGCCCAAGGCAGCGGGGAAAGGCATAAAATATGGGGTCAAGGGTTGGCCCGGGGAACAATTCTTTTGCAAAGAAAACGGCGGAAAAACCTCTCCATTCCGGttttttttGCCAACAGGTTTAAAAAATTTCCCAAAACAATTTTCAAAA


Protein sequences

Name Description Sequence
Ptc.1317 translated coding region predicted by ESTScan from UniGene Ptc.1317

QSVSLAWGNLRGSLPTEIVEMKHLVNIELHYNKFTGEVPLEWWRARNLVRINLAENSIEGEIPPEIKNLEDVKGLFLSENLFRGTLPDEIGDLSSVSFFRLSRNLLEGTLPSTVGQMSQLGEIWLHRNYLTGALPTEIGNLSKLARLRLQFNSFRGELPGQLYGLTSLDRLDLYNCNFTGTISPAIGNLTNMSFLRLHDNNFFGGIPTELGQLSVLSSLMLQGNQLTGTIPDSICEVRQNWVPFEELEADCAGSSSGGPEVTCPDLCCTSCCERQNVCTPTPTRMI


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-233 L domain-like,LRR

QSVSLAWGNLRGSLPTEIVEMKHLVNIELHYNKFTGEVPLEWWRARNLVRINLAENSIEGEIPPEIKNLEDVKGLFLSENLFRGTLPDEIGDLSSVSFFRLSRNLLEGTLPSTVGQMSQLGEIWLHRNYLTGALPTEIGNLSKLARLRLQFNSFRGELPGQLYGLTSLDRLDLYNCNFTGTISPAIGNLTNMSFLRLHDNNFFGGIPTELGQLSVLSSLMLQGNQLTGTIPDS

HMMPanther: PTHR24420
2-242 FAMILY NOT NAMED,FAMILY NOT NAMED

SVSLAWGNLRGSLPTEIVEMKHLVNIELHYNKFTGEVPLEWWRARNLVRINLAENSIEGEIPPEIKNLEDVKGLFLSENLFRGTLPDEIGDLSSVSFFRLSRNLLEGTLPSTVGQMSQLGEIWLHRNYLTGALPTEIGNLSKLARLRLQFNSFRGELPGQLYGLTSLDRLDLYNCNFTGTISPAIGNLTNMSFLRLHDNNFFGGIPTELGQLSVLSSLMLQGNQLTGTIPDSICEVRQNWV

Gene3D: G3DSA:3.80.10.10
4-145 no description

SLAWGNLRGSLPTEIVEMKHLVNIELHYNKFTGEVPLEWWRARNLVRINLAENSIEGEIPPEIKNLEDVKGLFLSENLFRGTLPDEIGDLSSVSFFRLSRNLLEGTLPSTVGQMSQLGEIWLHRNYLTGALPTEIGNLSKLA

HMMPfam: PF00560
IPR001611
47-69 LRR_1
Leucine-rich repeat

NLVRINLAENSIEGEIPPEIKNL

Gene3D: G3DSA:3.80.10.10
146-235 no description

RLRLQFNSFRGELPGQLYGLTSLDRLDLYNCNFTGTISPAIGNLTNMSFLRLHDNNFFGGIPTELGQLSVLSSLMLQGNQLTGTIPDSIC

HMMPfam: PF00560
IPR001611
167-189 LRR_1
Leucine-rich repeat

SLDRLDLYNCNFTGTISPAIGNL

HMMPfam: PF00560
IPR001611
216-235 LRR_1
Leucine-rich repeat

LSSLMLQGNQLTGTIPDSIC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox