PRGDB00080702 (Ptc.2358)

From PRG Wiki
Jump to: navigation, search
Ptc.2358
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 144669784 (CT920932)
Gene Class Unknown
Domain Type
Gene Species Dimocarpus longan

Comment?

CT920932 Phaeodactylum tricornutum tropical acession Pt9 (cold stress; grown at 15 degrees celsius) Phaeodactylum tricornutum cDNA 5', mRNA sequence

DNA Sequence

AGCGTCGGCGTCTTTCGCTCGGTATCGCGCTCCTCAAGCAGCCCACGTTGCTCTTCCTCGACGAACCGACCACTGGTTTGGACGCAGCCTCGGCGGAAAATATTATGCAAGAAATCGTCCGGGTGGCTAAAGAAGAGAATTTGATTATTCTCTGTACCATCCATCAGCCATCGACCAAGGTCTACCAAGGTTTCGACGAAGTCATGGTATTGTCGAAAGGCCGTGAGGCTTACACCGGGAACGTTAAAGAAGCTGTTCCTTATTTCGAGAGTATCGGCTACCCGCTTCCTCCGCAAACAAATCCTGCCGAACACTTTCTTGATATGGTGAATGCTGATTTTTCGGACGACGCTGAAGTTGACCGCATTTTGGACACTTGGCAAGAAAAGCGTCCAGGCGCGGGCTCTTCGCATCACAAAAAGGGATTCGGTGGAGTCGACAACGATGATGAGGGTCAAGAGGGCGTTGCCGACGTCAAGCGCGCTCTCTTGCGCAAGGAAATTAGTATCATGTTCAGTCGGCATTTGAAACTCATGATGCGGGATCCTGTCCTGTATTCGGGCCGAGCGGTGATATTCTTTGTAGTTACTTTGCTTTTTTCACTGGTATATTTGAACGCTCGAGACTATTCTCAGGATCAGGCTTTGAACAAAATGTGGATCGTGCTTTGGTTGGTGTCGGTCCCAAGCAACATGGGTGTCGTTGCCGTATACGCTCTGAATGAAGAGTTCAAATCAATTCTTCGCGAGTCCAAGAACGGAATGGCGAGTCCTCTGAGTTACGCCCTCGCTAAAACAGTTCCGGGTGATCCCATCATGGTTTGTTTTTGCCAAATTCGCTTTGGTGATTGCCCCTTTCGTCATAATCGAAATGCCTTGGGGACAACTTCGGGGTTGCCATCCTCCTCCAACCCTGCCCCCAGGTACGTCTTTTAATGGTGTCGGGGAAAGGCTGGCAGTTGGGGTTTGCAAATCCCAACCTTTGGAAAGGGCCCAAtttttaaaacttttgggttttggaacctttttggtttggggggggTTCTTGAATCTTCAA


Protein sequences

Name Description Sequence
Ptc.2358 translated coding region predicted by ESTScan from UniGene Ptc.2358

XRRRLSLGIALLKQPTLLFLDEPTTGLDAASAENIMQEIVRVAKEENLIILCTIHQPSTKVYQGFDEVMVLSKGREAYTGNVKEAVPYFESIGYPLPPQTNPAEHFLDMVNADFSDDAEVDRILDTWQEKRPGAGSSHHKKGFGGVDNDDEGQEGVADVKRALLRKEISIMFSRHLKLMMRDPVLYSGRAVIFFVVTLLFSLVYLNARDYSQDQALNKMWIVLWLVSVPSNMGVVAVYALNEEFKSILRESKNGMASPLSYALAKTVPGDPIMVCFCQIRFGDCPFRHNRNALGTTSGLPSSSNPAPRYVF


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
2-105 no description

RRRLSLGIALLKQPTLLFLDEPTTGLDAASAENIMQEIVRVAKEENLIILCTIHQPSTKVYQGFDEVMVLSKGREAYTGNVKEAVPYFESIGYPLPPQTNPAEH

superfamily: SSF52540
2-123 P-loop containing nucleoside triphosphate hydrolases

RRRLSLGIALLKQPTLLFLDEPTTGLDAASAENIMQEIVRVAKEENLIILCTIHQPSTKVYQGFDEVMVLSKGREAYTGNVKEAVPYFESIGYPLPPQTNPAEHFLDMVNADFSDDAEVDRI

HMMPanther: PTHR19241
2-276 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

RRRLSLGIALLKQPTLLFLDEPTTGLDAASAENIMQEIVRVAKEENLIILCTIHQPSTKVYQGFDEVMVLSKGREAYTGNVKEAVPYFESIGYPLPPQTNPAEHFLDMVNADFSDDAEVDRILDTWQEKRPGAGSSHHKKGFGGVDNDDEGQEGVADVKRALLRKEISIMFSRHLKLMMRDPVLYSGRAVIFFVVTLLFSLVYLNARDYSQDQALNKMWIVLWLVSVPSNMGVVAVYALNEEFKSILRESKNGMASPLSYALAKTVPGDPIMVCF

HMMPfam: PF01061
IPR013525
168-276 ABC2_membrane
ABC-2 type transporter

ISIMFSRHLKLMMRDPVLYSGRAVIFFVVTLLFSLVYLNARDYSQDQALNKMWIVLWLVSVPSNMGVVAVYALNEEFKSILRESKNGMASPLSYALAKTVPGDPIMVCF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox