PRGDB00080706 (Ptc.3505)

From PRG Wiki
Jump to: navigation, search
Ptc.3505
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 187012792 (CU709247)
Gene Class N
Domain Type NBS
Gene Species Dimocarpus longan

Comment?

CU709247 Phaeodactylum tricornutum Aerated culture of predominantly triradiate cells Phaeodactylum tricornutum cDNA clone KS0ASA4YM01 5', mRNA sequence

DNA Sequence

GACAAGTCCTGACTGTAAGTATCGAAGCAGACCAAACAAAGATACCACAAACACAATATTCCAGCGCAGTTTATAACCAACATGTCGGCCGAGGAGGAACAAAAACACGACGATGACCCTGTCGCTGAAGAAGATGGCACCGGTGTCGTCATCGAGAACCCCTCGACCAGCAAGATGGGTACTTCTAATCATCGCTCCACACACAGTCAGGGAATGGAAAGTTCTGTGCTCCGCTTCAAAAACGTCAATTTTGTGGTGGGCAAGAAAGATAAGCAAAAGAATATTCTCACGGATGTGTCTGGAACAGTGAAATGGGGTCATGTCCTCGCCATTATGGGACCGTCCGGTGCTGGTAAGACGACTCTCGTTTCCGCCTTGACCTTGGAAGGATTGTATGGAGAAGCGACTGGAAAGGTTACCCTCAACGGCGTTCCGTTGACTGACAAGATTTTCAAATCACACTGTTATGTTGTCAAGCAACACGATAAACATTGGCCGTACTTGACCTGTCGTGAAACACTTATGTTCGCAGCCGAACTCTACGATGTTGCTGTCAATCGTGCCGAAATGGCTTTGGTAGTGGACGAGATTCTCGACAAGATGGGCCTGAAAGTTTGCGAAAATACCCGCAACGGAAGTTTGTCCGGTGGACAGCGTCGTCGCCTTTCCCTCGGAATCGCTCTACTGAAGCAGCCCACAATGCTTTTCCTGGACGAGCCAACGTCTGGTTTGGAAGCGGCGTCAGCTTCTAACATTATGAGAGAAATTGTCCGGGTGGCCAAAGAAGAACGTCTTAATCTTATCTGCACCATCCATCAGCCTTCCACTAAAGTATACCAGGGTTTTGATGAACTCTGGCTCTGGCCCGAGGGCCCGAGGGCTTTAGGGGAGACCTGGAATGAAGCGATCCCCTTCCTTCAAAAGCCTCGGGCCTTCCCTTGCCTCCGGCAAAAAATTCCTGGCGAAGttttttttggaatttttGGCAACCTCGGATTTCCTCCCAATTAATTCCTTTGTATACAAACATTTTTCACACCCGGGGCGaaggaaaaaggcgcccgggggggaggaaaatcttttccccccaaaaaagaaaaggatttttaacacagcaaaaaaaaCACCAAAGGGGGTGTTGAGAAAAAAAGGAGAGAGGGGCGCCCCCCCTTTT


Protein sequences

Name Description Sequence
Ptc.3505 translated coding region predicted by ESTScan from UniGene Ptc.3505

MSAEEEQKHDDDPVAEEDGTGVVIENPSTSKMGTSNHRSTHSQGMESSVLRFKNVNFVVGKKDKQKNILTDVSGTVKWGHVLAIMGPSGAGKTTLVSALTLEGLYGEATGKVTLNGVPLTDKIFKSHCYVVKQHDKHWPYLTCRETLMFAAELYDVAVNRAEMALVVDEILDKMGLKVCENTRNGSLSGGQRRRLSLGIALLKQPTMLFLDEPTSGLEAASASNIMREIVRVAKEERLNLICTIHQPSTKVYQGFDELWLWPEGPRALGETW

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
29-264 P-loop containing nucleoside triphosphate hydrolases

TSKMGTSNHRSTHSQGMESSVLRFKNVNFVVGKKDKQKNILTDVSGTVKWGHVLAIMGPSGAGKTTLVSALTLEGLYGEATGKVTLNGVPLTDKIFKSHCYVVKQHDKHWPYLTCRETLMFAAELYDVAVNRAEMALVVDEILDKMGLKVCENTRNGSLSGGQRRRLSLGIALLKQPTMLFLDEPTSGLEAASASNIMREIVRVAKEERLNLICTIHQPSTKVYQGFDELWLWPEG

Gene3D: G3DSA:3.40.50.300
46-261 no description

ESSVLRFKNVNFVVGKKDKQKNILTDVSGTVKWGHVLAIMGPSGAGKTTLVSALTLEGLYGEATGKVTLNGVPLTDKIFKSHCYVVKQHDKHWPYLTCRETLMFAAELYDVAVNRAEMALVVDEILDKMGLKVCENTRNGSLSGGQRRRLSLGIALLKQPTMLFLDEPTSGLEAASASNIMREIVRVAKEERLNLICTIHQPSTKVYQGFDELWLW

HMMPanther: PTHR19241
49-258 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

VLRFKNVNFVVGKKDKQKNILTDVSGTVKWGHVLAIMGPSGAGKTTLVSALTLEGLYGEATGKVTLNGVPLTDKIFKSHCYVVKQHDKHWPYLTCRETLMFAAELYDVAVNRAEMALVVDEILDKMGLKVCENTRNGSLSGGQRRRLSLGIALLKQPTMLFLDEPTSGLEAASASNIMREIVRVAKEERLNLICTIHQPSTKVYQGFDEL

ProfileScan: PS50893
IPR003439
50-271 ABC_TRANSPORTER_2
ABC transporter-like

LRFKNVNFVVGKKDKQKNILTDVSGTVKWGHVLAIMGPSGAGKTTLVSALTLEGLYGEATGKVTLNGVPLTDKIFKSHCYVVKQHDKHWPYLTCRETLMFAAELYDVAVNRAEMALVVDEILDKMGLKVCENTRNGSLSGGQRRRLSLGIALLKQPTMLFLDEPTSGLEAASASNIMREIVRVAKEERLNLICTIHQPSTKVYQGFDELWLWPEGPRALGET

HMMSmart: SM00382
IPR003593
78-265 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

WGHVLAIMGPSGAGKTTLVSALTLEGLYGEATGKVTLNGVPLTDKIFKSHCYVVKQHDKHWPYLTCRETLMFAAELYDVAVNRAEMALVVDEILDKMGLKVCENTRNGSLSGGQRRRLSLGIALLKQPTMLFLDEPTSGLEAASASNIMREIVRVAKEERLNLICTIHQPSTKVYQGFDELWLWPEGP

HMMPfam: PF00005
IPR003439
93-215 ABC_tran
ABC transporter-like

TTLVSALTLEGLYGEATGKVTLNGVPLTDKIFKSHCYVVKQHDKHWPYLTCRETLMFAAELYDVAVNRAEMALVVDEILDKMGLKVCENTRNGSLSGGQRRRLSLGIALLKQPTMLFLDEPTS

PatternScan: PS00211
IPR017871
187-201 ABC_TRANSPORTER_1
ABC transporter, conserved site

LSGGQRRRLSLGIAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox