PRGDB00080707 (Ptc.4207)

From PRG Wiki
Jump to: navigation, search
Ptc.4207
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219130520 (XM_002185376)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

ATGGCCGACGTTGTGTTCTATTCCCTCGTAGCTCTCGCCAAGGCGGGCATTGAATGCTGTCAAAACGCCCAAGTCTACAAGGCTGAAGCAGTCCGCATCGGCGAACGGCTAACGATGATAGTGGCTCTAGCGCGTCAATGGAGAGGTGGTTGTAGCAACGAACAACTCGAATGCTTTCACAGAGTCGTGGTCAATGTACACGAATGCATGAAAGCTGCCTTTTTGTCTGAGAGCAAGAGTGTTGCATGGAACAGAAAGTTAAAGGTGACGTTACAATCTCAAATGCTGCTCGAGAATCTCGTCCAAGCGGAGAGCCAGTTGAACACCGCCATCGCTGACTTTCAAGTGATGCAGTCCAACACAATCTTTTCAGACTTTCTTGACTTCAAAGAAGGGGTCAAAGAAATGCTTGATCGGTTTGGTTCGTGTGTTATGAACCAATCGGGCTCCGTTACAATCAAACAGCAATTTGATCAGGTCTTGGCGGAGACTCAAGATCAAGCTCCCGAAATCGGCATTTCCACTCCCGAGGATGGTAGATACAACGCAACAATAAAATATGACCCTGCTGGTCAAACGGGTGGCAAGCTACAGCAGCGGAAAAAGTCAATGTTTCGTCCATCCGAAGAAGACGTGCTCGCAATTACGCTCAGACCTTCCTTGTTAGTCTTTTGCGACGATCGCAACAACCTTCTCGGAGGTGGAGGATTCGCAGAAGTCTTTCACGGAACCTATGACGGACGACCAGTCGCCATCAAGCGCCTCAATGTATCCATTCGAGATGTGATGTCACTATCGACTAAGCAGATTACTAGCGATGTGGAACAACTTGCTGCCGAAGCTATCCTAACCCACAAATGCGGTGCACATTCCAACATCATCCAGGTACTTGGCTGCATCACCGCACTGAATAAAACCACGAGACCCTTGCTCGTAATGGAACTGATGCACATTACGCTATTTGATGCGCTGCATGACCACCGTGTAAAAGATAAACTGACATTTTCCCACTGCCTCTTTCTGTTAAAAGGTATTGCTGGAGCCTTGGAGTTTCTCCATCTTCAAGGAATTGTCCACCATGACATCAAATCTCTCAACATTTTGCTGAGCGAAGACCTCACCGTAGCCAAATTGGCCGACTTTGGAGAATCGAAAGTGAAAGGTCTTAACACAACAAAACCACGGCTTGAGAGAATAATGACAACGTCTTGTCATCAGGGCAACATAATTGCAGGGACAGCAGCCTACCAGGCACCAGAGATTCTCTCGGAAGATGTCAATGACATATCACGCGTTTGCGAAGTCTATTCTTTCGGGGTCACAGTTTGGGAGTGCGTGACAAGAGAGATACCACATATGGGTAAAAAAGAAGGGTCTATAGCTCTTTTGGCTGCAAACAAGAAACACTTGCCTATGCTTGCGATGCCCTTGCACCCCTCAAAGGATCTTCCAACAACAGAAATCGGTTCCTGGGAAGCGCTGAGAAAAGTCGCCGCATTGTGCCTCTCCCGCGACCGCTCGATGAGACCCACTGCTTCTGGAGTTGTTGAGCTTTGGCACCACGTCGACACTCCTTCATTCCCTCCGGAGAGCTTGTGTTATGCCAGTACCAGGTGTGTTTCCGATCCTCCACTACCGGCTCACTCGGCATCTCAGAAATCAACAATTCGAGGCCACGCGTTGGATGCGCCAGATTTCGAAGAAGAATCCAAGGCAGGAGGTCTGAGGAAACGTCGCTACACTGTACTGTCAGTTATCGCAATCCTTATCGGGTTGATAGTGATCATAGTTCTTCGCTTACAGAGGTCCAGGGCATCTTCAGGTAAATCTACGACATTCCCTGAATCGGAAGCGCCGTCTGGTATTTCAATCTCCACTCTCCCGCCCACCCAATTACCAAGGGCATCTCTGATACCGCAAACAGAGGCTCCGGTCTCTTTGTCCCCACCTACAGGTCCGCCGCTGTCATCCCAATCTCTAACAACCCAGCCATCATCAACATCCATGCCGCCGAGAGCAGGTCCGGTTTCCACGACCCCGCCCACTATTTCACCTCTCACGGCCCAATCTCCAACAACAAGCACGCAACCACGTCTGTCCTTTCAAACAACACAAGAGCTTTACGATGCTGTTGATATTTACACTGCCGCGACGGACTCCACAAATTCTACGGCGGCAGTGACGTACGGCTATCCCATCGGATCATGGGATGTGTCCCAAATCACCGATTTTTCGCAAGTCTTCGATAGCTTGAATCGAAACAGCGCGGTTGGGATTTTCGACGAAGATGTGAGCGGCTGGGATGTCTCTGCCGCAACGACCATGTCTGGCATGTTCAAGGGTGCGTCTACTTTTAGCGGCGATCTTTCGTTGTGGAACGTAAGCCAGGTAAGGGATACGTCATCCATGTTTGAGGGAGCAACCTCGTTCGACGGTAACGTCTCGCTATGGAATGTTGGGCAGGTAACGAACATGTCTTCCATGTTTTTTGAGGCGAGTGCCTTCAATGGCGACCTCGCTTCGTGGAACGTGGGGCAGGTAACGAACATGAGTTCAATATTCTTCCTTGCGTCTAGCTTTACAAGCGATCTTTCGTCGTGGAATGTTGCACAGGTAACGGATTGGTTTGCCGCGTTCAAAGGAGCAGCCGCCTTTACCAGTGACCTTTCCAAGTGGAATGTGGGAAAGGTCACAAACATGCGTTTGATGTTCTACCACGCGTTTGACTTTAATAGCGACCTCACGTCGTGGGATGTTAGCCAGGTGACGGATTTGTCGTCAATGCTCGAGGGTGCGACCGCATTCACCGGCAACCTCTGCTCGTGGCTCACACAGATTCCACCGAGTTGCAACGTGGATCGAATGTTCTCGTTCGCCTCGTCCTGTTCAGACCTTGCAGCCACCGTACTCCCGGACGGACCCATGTGCCATGCTTGCGTTCCAATGTAA


Protein sequences

Name Description Sequence
Ptc.4207 translated coding region predicted by ESTScan from UniGene Ptc.4207

MADVVFYSLVALAKAGIECCQNAQVYKAEAVRIGERLTMIVALARQWRGGCSNEQLECFHRVVVNVHECMKAAFLSESKSVAWNRKLKVTLQSQMLLENLVQAESQLNTAIADFQVMQSNTIFSDFLDFKEGVKEMLDRFGSCVMNQSGSVTIKQQFDQVLAETQDQAPEIGISTPEDGRYNATIKYDPAGQTGGKLQQRKKSMFRPSEEDVLAITLRPSLLVFCDDRNNLLGGGGFAEVFHGTYDGRPVAIKRLNVSIRDVMSLSTKQITSDVEQLAAEAILTHKCGAHSNIIQVLGCITALNKTTRPLLVMELMHITLFDALHDHRVKDKLTFSHCLFLLKGIAGALEFLHLQGIVHHDIKSLNILLSEDLTVAKLADFGESKVKGLNTTKPRLERIMTTSCHQGNIIAGTAAYQAPEILSEDVNDISRVCEVYSFGVTVWECVTREIPHMGKKEGSIALLAANKKHLPMLAMPLHPSKDLPTTEIGSWEALRKVAALCLSRDRSMRPTASGVVELWHHVDTPSFPPESLCYASTRCVSDPPLPAHSASQKSTIRGHALDAPDFEEESKAGGLRKRRYTVLSVIAILIGLIVIIVLRLQRSRASSGKSTTFPESEAPSGISISTLPPTQLPRASLIPQTEAPVSLSPPTGPPLSSQSLTTQPSSTSMPPRAGPVSTTPPTISPLTAQSPTTSTQPRLSFQTTQELYDAVDIYTAATDSTNSTAAVTYGYPIGSWDVSQITDFSQVFDSLNRNSAVGIFDEDVSGWDVSAATTMSGMFKGASTFSGDLSLWNVSQVRDTSSMFEGATSFDGNVSLWNVGQVTNMSSMFFEASAFNGDLASWNVGQVTNMSSIFFLASSFTSDLSSWNVAQVTDWFAAFKGAAAFTSDLSKWNVGKVTNMRLMFYHAFDFNSDLTSWDVSQVTDLSSMLEGATAFTGNLCSWLTQIPPSCNVDRMFSFASSCSDLAATVLPDGPMCHACVPM

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
198-519 Kinase_like
Protein kinase-like domain

QQRKKSMFRPSEEDVLAITLRPSLLVFCDDRNNLLGGGGFAEVFHGTYDGRPVAIKRLNVSIRDVMSLSTKQITSDVEQLAAEAILTHKCGAHSNIIQVLGCITALNKTTRPLLVMELMHITLFDALHDHRVKDKLTFSHCLFLLKGIAGALEFLHLQGIVHHDIKSLNILLSEDLTVAKLADFGESKVKGLNTTKPRLERIMTTSCHQGNIIAGTAAYQAPEILSEDVNDISRVCEVYSFGVTVWECVTREIPHMGKKEGSIALLAANKKHLPMLAMPLHPSKDLPTTEIGSWEALRKVAALCLSRDRSMRPTASGVVELW

ProfileScan: PS50011
IPR000719
226-527 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DDRNNLLGGGGFAEVFHGTYDGRPVAIKRLNVSIRDVMSLSTKQITSDVEQLAAEAILTHKCGAHSNIIQVLGCITALNKTTRPLLVMELMHITLFDALHDHRVKDKLTFSHCLFLLKGIAGALEFLHLQGIVHHDIKSLNILLSEDLTVAKLADFGESKVKGLNTTKPRLERIMTTSCHQGNIIAGTAAYQAPEILSEDVNDISRVCEVYSFGVTVWECVTREIPHMGKKEGSIALLAANKKHLPMLAMPLHPSKDLPTTEIGSWEALRKVAALCLSRDRSMRPTASGVVELWHHVDTPSF

Gene3D: G3DSA:3.30.200.20
229-302 G3DSA:3.30.200.20

NNLLGGGGFAEVFHGTYDGRPVAIKRLNVSIRDVMSLSTKQITSDVEQLAAEAILTHKCGAHSNIIQVLGCITA

HMMPfam: PF00069
IPR017442
230-517 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NLLGGGGFAEVFHGTYDGRPVAIKRLNVSIRDVMSLSTKQITSDVEQLAAEAILTHKCGAHSNIIQVLGCITALNKTTRPLLVMELMHITLFDALHDHRVKDKLTFSHCLFLLKGIAGALEFLHLQGIVHHDIKSLNILLSEDLTVAKLADFGESKVKGLNTTKPRLERIMTTSCHQGNIIAGTAAYQAPEILSEDVNDISRVCEVYSFGVTVWECVTREIPHMGKKEGSIALLAANKKHLPMLAMPLHPSKDLPTTEIGSWEALRKVAALCLSRDRSMRPTASGVVE

HMMPanther: PTHR23257
230-682 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

NLLGGGGFAEVFHGTYDGRPVAIKRLNVSIRDVMSLSTKQITSDVEQLAAEAILTHKCGAHSNIIQVLGCITALNKTTRPLLVMELMHITLFDALHDHRVKDKLTFSHCLFLLKGIAGALEFLHLQGIVHHDIKSLNILLSEDLTVAKLADFGESKVKGLNTTKPRLERIMTTSCHQGNIIAGTAAYQAPEILSEDVNDISRVCEVYSFGVTVWECVTREIPHMGKKEGSIALLAANKKHLPMLAMPLHPSKDLPTTEIGSWEALRKVAALCLSRDRSMRPTASGVVELWHHVDTPSFPPESLCYASTRCVSDPPLPAHSASQKSTIRGHALDAPDFEEESKAGGLRKRRYTVLSVIAILIGLIVIIVLRLQRSRASSGKSTTFPESEAPSGISISTLPPTQLPRASLIPQTEAPVSLSPPTGPPLSSQSLTTQPSSTSMPPRAGPVSTTPPT

HMMPanther: PTHR23257:SF99
230-682 PTHR23257:SF99,TGF-BETA-ACTIVATED KINASE 1

NLLGGGGFAEVFHGTYDGRPVAIKRLNVSIRDVMSLSTKQITSDVEQLAAEAILTHKCGAHSNIIQVLGCITALNKTTRPLLVMELMHITLFDALHDHRVKDKLTFSHCLFLLKGIAGALEFLHLQGIVHHDIKSLNILLSEDLTVAKLADFGESKVKGLNTTKPRLERIMTTSCHQGNIIAGTAAYQAPEILSEDVNDISRVCEVYSFGVTVWECVTREIPHMGKKEGSIALLAANKKHLPMLAMPLHPSKDLPTTEIGSWEALRKVAALCLSRDRSMRPTASGVVELWHHVDTPSFPPESLCYASTRCVSDPPLPAHSASQKSTIRGHALDAPDFEEESKAGGLRKRRYTVLSVIAILIGLIVIIVLRLQRSRASSGKSTTFPESEAPSGISISTLPPTQLPRASLIPQTEAPVSLSPPTGPPLSSQSLTTQPSSTSMPPRAGPVSTTPPT

PatternScan: PS00107
IPR017441
232-253 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGGGGFAEVFHGTYDGRPVAIK

Gene3D: G3DSA:1.10.510.10
303-517 G3DSA:1.10.510.10

LNKTTRPLLVMELMHITLFDALHDHRVKDKLTFSHCLFLLKGIAGALEFLHLQGIVHHDIKSLNILLSEDLTVAKLADFGESKVKGLNTTKPRLERIMTTSCHQGNIIAGTAAYQAPEILSEDVNDISRVCEVYSFGVTVWECVTREIPHMGKKEGSIALLAANKKHLPMLAMPLHPSKDLPTTEIGSWEALRKVAALCLSRDRSMRPTASGVVE

PatternScan: PS00108
IPR008271
357-369 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHHDIKSLNILL

HMMPfam: PF03382
IPR005046
813-899 DUF285
Protein of unknown function DUF285, lipoprotein pr

NVSLWNVGQVTNMSSMFFEASAFNGDLASWNVGQVTNMSSIFFLASSFTSDLSSWNVAQVTDWFAAFKGAAAFTSDLSKWNVGKVTN

HMMTigr: TIGR02167
IPR011889
828-852 Liste_lipo_26
Bacterial surface protein 26-residue repeat

MFFEASAFNGDLASWNVGQVTNMSS

HMMTigr: TIGR02167
IPR011889
879-901 Liste_lipo_26
Bacterial surface protein 26-residue repeat

FKGAAAFTSDLSKWNVGKVTNMR

HMMTigr: TIGR02167
IPR011889
903-927 Liste_lipo_26
Bacterial surface protein 26-residue repeat

MFYHAFDFNSDLTSWDVSQVTDLSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox