PRGDB00080712 (Ptc.5864)

From PRG Wiki
Jump to: navigation, search
Ptc.5864
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219128915 (XM_002184611)
Gene Class N
Domain Type NBS
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

ATGACACTGAACGATGATCCGACCCTTCATCCAAAGGAATCGGTAGCATCGGACGCCGCCACAGTGTACCTGCCTTCGGGTGAAGGGAGAACCACTGCCGCTACTTTTCCTTATTCTCGACACCGACCACAGATACCGTGCATGACGGATTTACGCAAATGGCTCCAAGCATCCCGAACGCCGCGAAGGTTGGTCGTACTATTCGTCCTGCTGGAGTCTCTGGCATTCCAGAAAGGATCGATGCGAGTGACGGCAGAGAGCGAAGTACCCGACAACGTGGCAGGCCAGCTGTTGCGCCAGACGGTAAAGGCTGCAGCAGCCTCGTCTCCGTCGCGAGATAGCTTGGACGGCGCCACTGCTAGCGGACTCGTCTGGAGTGATCTGAGTGTAGTTTCGTCCAATCGGGATGTCACCCTTCTGCACCCGTTTTCTGGATGGATCACCAGCGGTCAGATTGGCGGGATCCTCGGACCGAGCGGAAGTGGCAAGTCAACTTTTCTATCGGCCCTCTCGGGTTCTTCACGACAACTTTACCAAACCGGGCAAGTCTGGCACTATCTACATACCGTTGTGCACGGCTCCAAGGACACACAAACACCGATACAATTGTCTCGAATACCCACACAAGAGGTTGCTTGGCTTCAGCAACACGACGATTTTTTCAGCATGCTAACGGTCCGGGAGACTCTAGATTTGGCGGCATATTTAGAGCTACCCCACTTAGTCCTGTCGCAACGAGACGCTTTGGTTCAAACTCACTTGGATGCGCTGGGCCTAGCTCACGCCGCCGACCGACCAATTGGCTCGGATCTTACCGGTTTGGGCACTGCACGCTTATCCGGTGGTGAGCGCCGACGATTGTCGGTGGCGTTGGAACTGTTGACGGAAAAACAACTTCTTTTAGCGGATGAACCCACGTCGGGTTTGGACAGCAGTATCAGTGTCAAAGTGATGCAAAATATCCGAGACGTTTGTCGCAAGCGAAATATCCCTTGCTTATGTGCAATTCATCAGCCTCGATCATCCATTTGGCACTTATTGGATACCCTCATCCTGATGGCCCCCGGTGGACGCGTGGTATACGCCGGCCCGAAATCCGAAGCCGTCGCATATTTTGCGACCCAAGGGTACCGTTGCCCCGACGCGACCAACCCGGCCGAGTACTTTGTCGATCTCGTTTCCGTCGATACCGAAGACGAGCAGGTGGCCGCTATCGACGAAGCACGGATTGATAAACTCGCTTCCGTCTTTCGTGACTACCAACAAACATCTTTGCTTCTGCCTGCCAAACGACCTCAAGTGAATTTGAGTCTGGATATCGAGACTGATATACAACAACCTTCAAATGGTCAATCGATGAGACGGGCTTTCCAAGAAAAAAGCCAACTTGGGCTCCTGAAATTTCTGTGGGTTCCACGATTGGGAGCCTTGCTAAAGAGGTCGTGGCGACAAAATGTTCGCAACTGGGAAATCAATATTTTCCGAGCGTTCGCCAGCGCGGGTAACGCGATTCTCCTGGCTCAAATCTTTCCAACTGTCCGAGGAAGTGTCGCCAAAGCCAATAGTGTAGCCGACAGGGTGGCACTGTTGTCGTTCGGTGCAATCAACATGTGCTTTATTGCATTTATGAAGACTGTCACGTTAATCGCGGAAGAGAAACCGGTTGTTCAACGGGAACAATCACGTCGTCAGTACTCGAGCTTGGAGTACCTGGTGGCCAAGGTTTTAGCAGAATTTCCCTTGGACTCCTTGTTTTCCGCTATCTTTACAGCCTTCCTAAAAAAGTGCTCAGGAGTCCGGATTTCGTGGGCCAAGCTGACTGGGGTCTTTAGTTTGTTGACGGTGTCTGGCGCTTCGCTTGGTTTGATGCTGGGCAGCTGGCTTCCAACCGAAAAACTGGCTACGACGGGCAGTATTCCAGTTCTAGTCGTATTGATGGTTGTGGGTATCATCAATCCGAGTGGCGTAGATCAGTCCACCCCTCCACCGGCGGTCGTGCAGGTATTGAAACGTTGTAGCCCATTTGCCTACGCTATTGAAGCGCTCTGTCTTGGGGAGTACCCCGGAATGGAATTCGAACGTCAGTCAGGCTGGTTCGGCCGTATCAGGGACTTGCCTAGAATGGGCGGATTGGCCATGGTTCGAAATGGTGATCAAGTCCTGGAGGCGCTGGGCTTACAAGACAAGGGGTATGTTCGAGTCATGCAACACCTTGGAGTATTGTCTGCTGCGTACCTGGCAGTTAGTTGGCTGGGCATGCTTGTACAGGGTAGAAAACATGGCATGCATGGTGCGGTCGAAGCGGACACTAGCCAGCACGTACAGCGAACCAAGGCTCCAAAGGACACCGAGGGCAGCTTTCTGTCCAAGTCAACAACGGAAACGTCAACATCACAACGACATTTGAAGGTTCCTTTAAAGATCCGAGTCTAA


Protein sequences

Name Description Sequence
Ptc.5864 translated coding region predicted by ESTScan from UniGene Ptc.5864

MTLNDDPTLHPKESVASDAATVYLPSGEGRTTAATFPYSRHRPQIPCMTDLRKWLQASRTPRRLVVLFVLLESLAFQKGSMRVTAESEVPDNVAGQLLRQTVKAAAASSPSRDSLDGATASGLVWSDLSVVSSNRDVTLLHPFSGWITSGQIGGILGPSGSGKSTFLSALSGSSRQLYQTGQVWHYLHTVVHGSKDTQTPIQLSRIPTQEVAWLQQHDDFFSMLTVRETLDLAAYLELPHLVLSQRDALVQTHLDALGLAHAADRPIGSDLTGLGTARLSGGERRRLSVALELLTEKQLLLADEPTSGLDSSISVKVMQNIRDVCRKRNIPCLCAIHQPRSSIWHLLDTLILMAPGGRVVYAGPKSEAVAYFATQGYRCPDATNPAEYFVDLVSVDTEDEQVAAIDEARIDKLASVFRDYQQTSLLLPAKRPQVNLSLDIETDIQQPSNGQSMRRAFQEKSQLGLLKFLWVPRLGALLKRSWRQNVRNWEINIFRAFASAGNAILLAQIFPTVRGSVAKANSVADRVALLSFGAINMCFIAFMKTVTLIAEEKPVVQREQSRRQYSSLEYLVAKVLAEFPLDSLFSAIFTAFLKKCSGVRISWAKLTGVFSLLTVSGASLGLMLGSWLPTEKLATTGSIPVLVVLMVVGIINPSGVDQSTPPPAVVQVLKRCSPFAYAIEALCLGEYPGMEFERQSGWFGRIRDLPRMGGLAMVRNGDQVLEALGLQDKGYVRVMQHLGVLSAAYLAVSWLGMLVQGRKHGMHGAVEADTSQXRTANQGSKGHRGQLSVQVNNGNVNITTTFEGSFKDPSLX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
52-754 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

RKWLQASRTPRRLVVLFVLLESLAFQKGSMRVTAESEVPDNVAGQLLRQTVKAAAASSPSRDSLDGATASGLVWSDLSVVSSNRDVTLLHPFSGWITSGQIGGILGPSGSGKSTFLSALSGSSRQLYQTGQVWHYLHTVVHGSKDTQTPIQLSRIPTQEVAWLQQHDDFFSMLTVRETLDLAAYLELPHLVLSQRDALVQTHLDALGLAHAADRPIGSDLTGLGTARLSGGERRRLSVALELLTEKQLLLADEPTSGLDSSISVKVMQNIRDVCRKRNIPCLCAIHQPRSSIWHLLDTLILMAPGGRVVYAGPKSEAVAYFATQGYRCPDATNPAEYFVDLVSVDTEDEQVAAIDEARIDKLASVFRDYQQTSLLLPAKRPQVNLSLDIETDIQQPSNGQSMRRAFQEKSQLGLLKFLWVPRLGALLKRSWRQNVRNWEINIFRAFASAGNAILLAQIFPTVRGSVAKANSVADRVALLSFGAINMCFIAFMKTVTLIAEEKPVVQREQSRRQYSSLEYLVAKVLAEFPLDSLFSAIFTAFLKKCSGVRISWAKLTGVFSLLTVSGASLGLMLGSWLPTEKLATTGSIPVLVVLMVVGIINPSGVDQSTPPPAVVQVLKRCSPFAYAIEALCLGEYPGMEFERQSGWFGRIRDLPRMGGLAMVRNGDQVLEALGLQDKGYVRVMQHLGVLSAAYLAVSWLGML

superfamily: SSF52540
123-385 P-loop containing nucleoside triphosphate hydrolases

LVWSDLSVVSSNRDVTLLHPFSGWITSGQIGGILGPSGSGKSTFLSALSGSSRQLYQTGQVWHYLHTVVHGSKDTQTPIQLSRIPTQEVAWLQQHDDFFSMLTVRETLDLAAYLELPHLVLSQRDALVQTHLDALGLAHAADRPIGSDLTGLGTARLSGGERRRLSVALELLTEKQLLLADEPTSGLDSSISVKVMQNIRDVCRKRNIPCLCAIHQPRSSIWHLLDTLILMAPGGRVVYAGPKSEAVAYFATQGYRCPDATNP

ProfileScan: PS50893
IPR003439
123-380 ABC_TRANSPORTER_2
ABC transporter-like

LVWSDLSVVSSNRDVTLLHPFSGWITSGQIGGILGPSGSGKSTFLSALSGSSRQLYQTGQVWHYLHTVVHGSKDTQTPIQLSRIPTQEVAWLQQHDDFFSMLTVRETLDLAAYLELPHLVLSQRDALVQTHLDALGLAHAADRPIGSDLTGLGTARLSGGERRRLSVALELLTEKQLLLADEPTSGLDSSISVKVMQNIRDVCRKRNIPCLCAIHQPRSSIWHLLDTLILMAPGGRVVYAGPKSEAVAYFATQGYRCP

Gene3D: G3DSA:3.40.50.300
128-387 no description

LSVVSSNRDVTLLHPFSGWITSGQIGGILGPSGSGKSTFLSALSGSSRQLYQTGQVWHYLHTVVHGSKDTQTPIQLSRIPTQEVAWLQQHDDFFSMLTVRETLDLAAYLELPHLVLSQRDALVQTHLDALGLAHAADRPIGSDLTGLGTARLSGGERRRLSVALELLTEKQLLLADEPTSGLDSSISVKVMQNIRDVCRKRNIPCLCAIHQPRSSIWHLLDTLILMAPGGRVVYAGPKSEAVAYFATQGYRCPDATNPAE

HMMSmart: SM00382
IPR003593
149-366 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

SGQIGGILGPSGSGKSTFLSALSGSSRQLYQTGQVWHYLHTVVHGSKDTQTPIQLSRIPTQEVAWLQQHDDFFSMLTVRETLDLAAYLELPHLVLSQRDALVQTHLDALGLAHAADRPIGSDLTGLGTARLSGGERRRLSVALELLTEKQLLLADEPTSGLDSSISVKVMQNIRDVCRKRNIPCLCAIHQPRSSIWHLLDTLILMAPGGRVVYAGPKS

HMMPfam: PF00005
IPR003439
164-307 ABC_tran
ABC transporter-like

STFLSALSGSSRQLYQTGQVWHYLHTVVHGSKDTQTPIQLSRIPTQEVAWLQQHDDFFSMLTVRETLDLAAYLELPHLVLSQRDALVQTHLDALGLAHAADRPIGSDLTGLGTARLSGGERRRLSVALELLTEKQLLLADEPTS

Seg: seg
253-264 seg

HLDALGLAHAAD

PatternScan: PS00211
IPR017871
279-293 ABC_TRANSPORTER_1
ABC transporter, conserved site

LSGGERRRLSVALEL

Seg: seg
291-304 seg

LELLTEKQLLLADE

HMMPfam: PF01061
IPR013525
474-684 ABC2_membrane
ABC-2 type transporter

LGALLKRSWRQNVRNWEINIFRAFASAGNAILLAQIFPTVRGSVAKANSVADRVALLSFGAINMCFIAFMKTVTLIAEEKPVVQREQSRRQYSSLEYLVAKVLAEFPLDSLFSAIFTAFLKKCSGVRISWAKLTGVFSLLTVSGASLGLMLGSWLPTEKLATTGSIPVLVVLMVVGIINPSGVDQSTPPPAVVQVLKRCSPFAYAIEALCL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox