PRGDB00080717 (Ptc.10122)

From PRG Wiki
Jump to: navigation, search
Ptc.10122
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 187012869 (CU715293)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Dimocarpus longan

Comment?

CU715293 Phaeodactylum tricornutum Aerated culture of predominantly triradiate cells Phaeodactylum tricornutum cDNA clone KS0ASA20YN15 5', mRNA sequence

DNA Sequence

GACGAGGCAAATAGCACAGATAACGCGAGCAAAAAGGATGACGACGATGACAAGGATCAGGCCGCGGCTTTGAAAAAGAATCCTATGGGGATAGAACTTCGTCCAACAATGCAGTTTCGTGATGTCTACGAGCTAACCGACAAGATTCACGCATCGCAACAAGCCATGATTTGGGAATGCAAGCATATTCATACGGGAAAAATTTATGCGGCAAAAGTCTGGAATATTGCGGCAAACCAACAGTCCGTCTTGGGTAAATCTTTGACGGAGACAGTTCTACATGAAGTTGCGGTCTTGAGAGCCATCAAGCACAAATATTTGATGGAAATTGTCGATTTTTTTGAAGAGGGCACTCACTTGTATCTAGTGATGGAGCGTATGGCTGGCGGTGACGTCTTTGATCGCATTCTCAAACGGAAGCACTACACGGAAAAAGATGCCAGAGATTTTGCTCGTATTTTGCTAGAAGGCGTAGCGCATATTCACGAACAAGGTATTGCCCATCGCGATCTCAAACCTCAAAATTTGTTACTCTCCTCCACGGATGATGATGCGGACATCAAGATTGCCGATTTTGGGTTTGCGTGTCGAGTCCATACCCCTATGTCTTTGACCACGCGTTGCGGGACACCAAGCTACGTGGCACCTGAAATTCTGAAGAACATTCCTTACGATCAAAGAGCTGATATGTGGAGCCGAGGAGTTATTTTGTTTGTATTGGTAGCGGGTTATCCTCCCCTTGTGGAAGAAAAACAAATGGAATTGTTTGCTCGTGTCCCAACCGGGTAAAGGGATTTTCCTGGGCAAGAAAGGGAAAACCGTGTCCCCGAAATCCAAGGAAAGTTATCAGCCATTTTGTGGGTTGAACCCCCCTGTATGCCGGTTGGACGGCCCATCAATGCCTAACCGAATGAATTGTTGGTAGCAAAAAAATGCCAGGCCCCTTTTGGCAGGGAACTCCCCGGCTGGGACAACTTAAGATGTCaaaaaaaaaaaaaaaaGCCAAATTGGTTAACTGGTCCCCCCGCCCCGTTTTGGGGGGaaaagaaaacacaaaaaagaacaagagctccgtggcttcccccaaaaaaCCAGGGCTTCTCAGAGAAATCCCGGACCCCCTTTTTTGCAAATTTTTATTAAGGTGTaaaaaaaaCACACCCGCGCGCTATCTCCTCCCCGAGAAAAGAAGTAAATACCTCAAACTTTGGGCGAGAGAGGAAAGAATTTTCCACCCCGGGGGTGATGAACACAGCTATTTTATTAATATTTATTTTATCTTCCCCC


Protein sequences

Name Description Sequence
Ptc.10122 translated coding region predicted by ESTScan from UniGene Ptc.10122

DEANSTDNASKKDDDDDKDQAAALKKNPMGIELRPTMQFRDVYELTDKIHASQQAMIWECKHIHTGKIYAAKVWNIAANQQSVLGKSLTETVLHEVAVLRAIKHKYLMEIVDFFEEGTHLYLVMERMAGGDVFDRILKRKHYTEKDARDFARILLEGVAHIHEQGIAHRDLKPQNLLLSSTDDDADIKIADFGFACRVHTPMSLTTRCGTPSYVAPEILKNIPYDQRADMWSRGVILFVLVAGYPPLVEEKQMELFARVPTGXRDFPGQERENRVPEIQGKLSAILWVEPPCMPVGRPINA

Domains

Domain Start-End Description Sequence

Seg: seg
7-26 seg

DNASKKDDDDDKDQAAALKK

HMMPanther: PTHR24349
19-267 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE

DQAAALKKNPMGIELRPTMQFRDVYELTDKIHASQQAMIWECKHIHTGKIYAAKVWNIAANQQSVLGKSLTETVLHEVAVLRAIKHKYLMEIVDFFEEGTHLYLVMERMAGGDVFDRILKRKHYTEKDARDFARILLEGVAHIHEQGIAHRDLKPQNLLLSSTDDDADIKIADFGFACRVHTPMSLTTRCGTPSYVAPEILKNIPYDQRADMWSRGVILFVLVAGYPPLVEEKQMELFARVPTGXRDFP

superfamily: SSF56112
IPR011009
25-290 Protein kinase-like (PK-like)
Protein kinase-like domain

KKNPMGIELRPTMQFRDVYELTDKIHASQQAMIWECKHIHTGKIYAAKVWNIAANQQSVLGKSLTETVLHEVAVLRAIKHKYLMEIVDFFEEGTHLYLVMERMAGGDVFDRILKRKHYTEKDARDFARILLEGVAHIHEQGIAHRDLKPQNLLLSSTDDDADIKIADFGFACRVHTPMSLTTRCGTPSYVAPEILKNIPYDQRADMWSRGVILFVLVAGYPPLVEEKQMELFARVPTGXRDFPGQERENRVPEIQGKLSAILWVEP

Gene3D: G3DSA:3.30.200.20
35-143 no description

PTMQFRDVYELTDKIHASQQAMIWECKHIHTGKIYAAKVWNIAANQQSVLGKSLTETVLHEVAVLRAIKHKYLMEIVDFFEEGTHLYLVMERMAGGDVFDRILKRKHYT

ProfileScan: PS50011
IPR000719
43-301 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELTDKIHASQQAMIWECKHIHTGKIYAAKVWNIAANQQSVLGKSLTETVLHEVAVLRAIKHKYLMEIVDFFEEGTHLYLVMERMAGGDVFDRILKRKHYTEKDARDFARILLEGVAHIHEQGIAHRDLKPQNLLLSSTDDDADIKIADFGFACRVHTPMSLTTRCGTPSYVAPEILKNIPYDQRADMWSRGVILFVLVAGYPPLVEEKQMELFARVPTGXRDFPGQERENRVPEIQGKLSAILWVEPPCMPVGRPINA

HMMSmart: SM00220
IPR002290
43-286 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELTDKIHASQQAMIWECKHIHTGKIYAAKVWNIAANQQSVLGKSLTETVLHEVAVLRAIKHKYLMEIVDFFEEGTHLYLVMERMAGGDVFDRILKRKHYTEKDARDFARILLEGVAHIHEQGIAHRDLKPQNLLLSSTDDDADIKIADFGFACRVHTPMSLTTRCGTPSYVAPEILKNIPYDQRADMWSRGVILFVLVAGYPPLVEEKQMELFARVPTGXRDFPGQERENRVPEIQGKLSAIL

HMMSmart: SM00219
IPR020635
43-282 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELTDKIHASQQAMIWECKHIHTGKIYAAKVWNIAANQQSVLGKSLTETVLHEVAVLRAIKHKYLMEIVDFFEEGTHLYLVMERMAGGDVFDRILKRKHYTEKDARDFARILLEGVAHIHEQGIAHRDLKPQNLLLSSTDDDADIKIADFGFACRVHTPMSLTTRCGTPSYVAPEILKNIPYDQRADMWSRGVILFVLVAGYPPLVEEKQMELFARVPTGXRDFPGQERENRVPEIQGKL

HMMPfam: PF00069
IPR017442
45-285 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LTDKIHASQQAMIWECKHIHTGKIYAAKVWNIAANQQSVLGKSLTETVLHEVAVLRAIKHKYLMEIVDFFEEGTHLYLVMERMAGGDVFDRILKRKHYTEKDARDFARILLEGVAHIHEQGIAHRDLKPQNLLLSSTDDDADIKIADFGFACRVHTPMSLTTRCGTPSYVAPEILKNIPYDQRADMWSRGVILFVLVAGYPPLVEEKQMELFARVPTGXRDFPGQERENRVPEIQGKLSAI

Gene3D: G3DSA:1.10.510.10
144-277 no description

EKDARDFARILLEGVAHIHEQGIAHRDLKPQNLLLSSTDDDADIKIADFGFACRVHTPMSLTTRCGTPSYVAPEILKNIPYDQRADMWSRGVILFVLVAGYPPLVEEKQMELFARVPTGXRDFPGQERENRVPE

PatternScan: PS00108
IPR008271
166-178 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IAHRDLKPQNLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox