PRGDB00080722 (Ptc.16965)

From PRG Wiki
Jump to: navigation, search
Ptc.16965
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 187012286 (CU715038)
Gene Class N
Domain Type NBS
Gene Species Dimocarpus longan

Comment?

CU715038 Phaeodactylum tricornutum Aerated culture of predominantly triradiate cells Phaeodactylum tricornutum cDNA clone KS0ASA21YJ04 5', mRNA sequence

DNA Sequence

CTTGCATATTGATATACAGACATTGCGTTGTTGATCAGCCGAAATTTGTGTGTTCATACCACTAACCTACTCTACTCGTACCATGACTGATAACCAATACGACAAAGCCGAGGAGAACGAGCCTGTGACGATGGAGGAGCCGGGAGCGATTACGCAACCGAACGCGAGAAATCCCCGGAGACTGCACTCGGCGCAGTCTAGCGGGATGGAATCGTCAGTCTTGCGCTTCAATCTCAATTTCACGGTAGGAAGTAAAGGGAATCAGAAGGCTATTCTCTCCGACGTGGCCGCGACGGTCAAGTGGGGACACGTATTGGCGATTATGGGGCCTAGTGGAGCCGGAAAAAGTGTATTGATTTCGGCATTGACACTGGACGCCCTCTTTGGTCGGACTGAAGGAAGGGTTACACTCAATGGCGTGCCTTTGACGGACAAGATTTTCAAGTCGCACTGTTACACCGTCGTGCAGCTCGACCAACACTGGCCCTACCTGACCTGTCGCGAAACCCTGCGCTACGCGGCGGAGCTCTACGACGTGGCCGCCAAGGAAGACATTGACGCCGTCGTGGACGAAATTGTCCAGAAAATGGGTCTCGACGTGTGCGTCGACACAAGAAACGCTCGTTTGAGCGGTGGTCAGCGTCGGCGTCTTTCGCTCGGTATCGCGCTCCTCAAGCACCCCACGTTGCTCTTCCTCGACGAACCGACCACTGGTTTGGACGCACCCTCGGCGGAAAATATTATGCAAGAAATCGTCCGGGTGGCTAAAGAAGAAAATTTGATTATTCTCTGTACCATCCATCCACCCTCAACCAAAGCCAACCAAGGTTTTCACAAAGTCATGGTAATGGCCAAAAGGCCTTGAGGCTTACACCGGGGAACGTTAAAAAAACTTTTCCTTATTTCCAGAATAATCGCCCACCCCCTTTCCCCCCAAAACAAACCCTGGCCGAAACCCTTTCCTTGAATGGGGGAATGCCAATTTTTCCGAAACAACCCTAAAATTTAACCCCCATTTTGAAACACTTTGGAAAAAAAGACGCCCCGGCGCCCGGGGCTTTTCCCCCATCACAAAAAAGGGAATCCCGGGGGGAATCCCAACAACCaaaaaaaaggggggcaaaaaaagggccctttccccccacatctcaacacccgcctccccccttttcccccaaaagaaaaaaataaattataaaaCATGTGTTTTTCAATCGTGTCCCGCCCTTATTTTTTATaaaaaaaaTACGCC


Protein sequences

Name Description Sequence
Ptc.16965 translated coding region predicted by ESTScan from UniGene Ptc.16965

MTDNQYDKAEENEPVTMEEPGAITQPNARNPRRLHSAQSSGMESSVLRFNLNFTVGSKGNQKAILSDVAATVKWGHVLAIMGPSGAGKSVLISALTLDALFGRTEGRVTLNGVPLTDKIFKSHCYTVVQLDQHWPYLTCRETLRYAAELYDVAAKEDIDAVVDEIVQKMGLDVCVDTRNARLSGGQRRRLSLGIALLKHPTLLFLDEPTTGLDAPSAENIMQEIVRVAKEENLIILCTIHPPSTKANQGFHKVMVMAKRP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
10-257 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

EENEPVTMEEPGAITQPNARNPRRLHSAQSSGMESSVLRFNLNFTVGSKGNQKAILSDVAATVKWGHVLAIMGPSGAGKSVLISALTLDALFGRTEGRVTLNGVPLTDKIFKSHCYTVVQLDQHWPYLTCRETLRYAAELYDVAAKEDIDAVVDEIVQKMGLDVCVDTRNARLSGGQRRRLSLGIALLKHPTLLFLDEPTTGLDAPSAENIMQEIVRVAKEENLIILCTIHPPSTKANQGFHKVMVMA

ProfileScan: PS50893
IPR003439
46-257 ABC_TRANSPORTER_2
ABC transporter-like

VLRFNLNFTVGSKGNQKAILSDVAATVKWGHVLAIMGPSGAGKSVLISALTLDALFGRTEGRVTLNGVPLTDKIFKSHCYTVVQLDQHWPYLTCRETLRYAAELYDVAAKEDIDAVVDEIVQKMGLDVCVDTRNARLSGGQRRRLSLGIALLKHPTLLFLDEPTTGLDAPSAENIMQEIVRVAKEENLIILCTIHPPSTKANQGFHKVMVMA

Gene3D: G3DSA:3.40.50.300
50-258 no description

NLNFTVGSKGNQKAILSDVAATVKWGHVLAIMGPSGAGKSVLISALTLDALFGRTEGRVTLNGVPLTDKIFKSHCYTVVQLDQHWPYLTCRETLRYAAELYDVAAKEDIDAVVDEIVQKMGLDVCVDTRNARLSGGQRRRLSLGIALLKHPTLLFLDEPTTGLDAPSAENIMQEIVRVAKEENLIILCTIHPPSTKANQGFHKVMVMAK

superfamily: SSF52540
50-258 P-loop containing nucleoside triphosphate hydrolases

NLNFTVGSKGNQKAILSDVAATVKWGHVLAIMGPSGAGKSVLISALTLDALFGRTEGRVTLNGVPLTDKIFKSHCYTVVQLDQHWPYLTCRETLRYAAELYDVAAKEDIDAVVDEIVQKMGLDVCVDTRNARLSGGQRRRLSLGIALLKHPTLLFLDEPTTGLDAPSAENIMQEIVRVAKEENLIILCTIHPPSTKANQGFHKVMVMAK

HMMSmart: SM00382
IPR003593
74-260 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

WGHVLAIMGPSGAGKSVLISALTLDALFGRTEGRVTLNGVPLTDKIFKSHCYTVVQLDQHWPYLTCRETLRYAAELYDVAAKEDIDAVVDEIVQKMGLDVCVDTRNARLSGGQRRRLSLGIALLKHPTLLFLDEPTTGLDAPSAENIMQEIVRVAKEENLIILCTIHPPSTKANQGFHKVMVMAKRP

HMMPfam: PF00005
IPR003439
90-210 ABC_tran
ABC transporter-like

VLISALTLDALFGRTEGRVTLNGVPLTDKIFKSHCYTVVQLDQHWPYLTCRETLRYAAELYDVAAKEDIDAVVDEIVQKMGLDVCVDTRNARLSGGQRRRLSLGIALLKHPTLLFLDEPTT

Seg: seg
181-193 seg

RLSGGQRRRLSLG

PatternScan: PS00211
IPR017871
182-196 ABC_TRANSPORTER_1
ABC transporter, conserved site

LSGGQRRRLSLGIAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox