PRGDB00080730 (Ptc.17179)

From PRG Wiki
Jump to: navigation, search
Ptc.17179
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219124403 (XM_002182458)
Gene Class N
Domain Type NBS
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

CGCAAACTTCTGGACAACGTTTGGGGGGAAGTTCCCCCGAAACAGACAACGGCTGTGATGGGTCCTTCTGGAGCTGGAAAGACATCATTACTCAATATCCTTGCTGGTCGCGCTCGCACTCATGGTCAAATTTCTATCGGAAAAGATATTCGTCTCAACAACTACAGTGTGGACCCCACAAAAATGAAGGTTCGTCAAATGATTGCATTTGTCGCTCAAGATGATAGCTTGCAGGAGACAGCTACACCTCGCGAAGCAATTCGTTTTTCAGCCAAGCTAAGGCTGCCTCGAGCTACCACAGAATCTCAATTGGATAAGCTGACGATCCGAATGCTGAGTGAACTTGGTTTGACGGCTTGCGCCGATGCAATGATTGGAGGTAGACTACTAAAGGGTGTTTCAGGCGGTGAACGCAAGCGAACTTCGGTTGGTGTGGAACTTGTGGTCAAGCCAGCGCTAGTCTTTCTGGACGAACCAACGAGTGGATTGGACTCATTCAGCGCGGTGCAGCTCTGTCAGGTCTTGAAGAAAGTAGCGAATGCTGGAGCCAGCGTGCTGTTTACAATCCACCAGCCGTCATCTGTCATCTTCAGTTCCTTTGATCATTTGCTAGTGATGAACAAAGGCCGTCTCATGTACACTGGGTCGGTCCAGGATGTTCCGTCCTATTTCGCGAATCGTGGTCATCCCAACCCGCCAAACTACAATCCTGCTGACTTCATTATGGATGTGGCGCAGTCAATTCCCGTGGAGCAGCTCACTAGAGAGGGCTTTTTTCCTGCTGATGAACGCAAAATGGCTGATCCGTTTGAACCAGAAGAAGGACAGGATGCGCTCGGGATAACTGTGACCCGACACACATATCGAGGTGTGGACATGTACGACGGTTCACCACCAGGGCTTCTGACTGAGATCAGACTGCTTTTCCAGAGGGAGGTAAACAATCTCAAACGTGATACATCAGCTCTGAAAGCGCGCTTTAGCCTTAGTCTCGTTGTTGGGCTAATTGTGGGAGTGATCTTTTGGAAGGTTGGCGAGACGGATAGTTCCGTTTCTACAAACCTGCAATCTCACTTCGGTGCAGTCATTCTTGTTTCTTTAATGAGCATGTTCGAAACCGCACAGCCCGCATTATTCGCATTTCCTGCCGAGCGCCCTGTCTTTCTCCGTGAATACAGCACGAATCACTATTCGGCAGCTTCTTACTTTCTGTCTCATTCCGTATTGGCTCATCAAATCTCACTACTTTTTCTTCCGGAGCAGTGTATTATCACATACTTCATGATTGACTTCCAATTGAACTTTGGTATGCTTTTTGCCGTTCTATACGTATTGGCCATGGCCAGCACGGCACTGGCTGTTCTTTTGGGATGTTCTGTGGAAGACCCGAAAGTAGCACAGGAAATGCTTTCCATCATCTTTGTTCCTCAGATGCTATTTTCCGGATTCTTTGTGACCATCGAACTCATTCCAGCTTGGTTGCGTTGGCTCCGGTACATTTTCCCGTTGACATACGCTATCCGTATTATCTTGGTGGAAGAATTT


Protein sequences

Name Description Sequence
Ptc.17179 translated coding region predicted by ESTScan from UniGene Ptc.17179

RKLLDNVWGEVPPKQTTAVMGPSGAGKTSLLNILAGRARTHGQISIGKDIRLNNYSVDPTKMKVRQMIAFVAQDDSLQETATPREAIRFSAKLRLPRATTESQLDKLTIRMLSELGLTACADAMIGGRLLKGVSGGERKRTSVGVELVVKPALVFLDEPTSGLDSFSAVQLCQVLKKVANAGASVLFTIHQPSSVIFSSFDHLLVMNKGRLMYTGSVQDVPSYFANRGHPNPPNYNPADFIMDVAQSIPVEQLTREGFFPADERKMADPFEPEEGQDALGITVTRHTYRGVDMYDGSPPGLLTEIRLLFQREVNNLKRDTSALKARFSLSLVVGLIVGVIFWKVGETDSSVSTNLQSHFGAVILVSLMSMFETAQPALFAFPAERPVFLREYSTNHYSAASYFLSHSVLAHQISLLFLPEQCIITYFMIDFQLNFGMLFAVLYVLAMASTALAVLLGCSVEDPKVAQEMLSIIFVPQMLFSGFFVTIELIPAWLRWLRYIFPLTYAIRIILVEEF

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-215 SSF52540

RKLLDNVWGEVPPKQTTAVMGPSGAGKTSLLNILAGRARTHGQISIGKDIRLNNYSVDPTKMKVRQMIAFVAQDDSLQETATPREAIRFSAKLRLPRATTESQLDKLTIRMLSELGLTACADAMIGGRLLKGVSGGERKRTSVGVELVVKPALVFLDEPTSGLDSFSAVQLCQVLKKVANAGASVLFTIHQPSSVIFSSFDHLLVMNKGRLMYTG

ProfileScan: PS50893
IPR003439
1-233 ABC_TRANSPORTER_2
ABC transporter-like

RKLLDNVWGEVPPKQTTAVMGPSGAGKTSLLNILAGRARTHGQISIGKDIRLNNYSVDPTKMKVRQMIAFVAQDDSLQETATPREAIRFSAKLRLPRATTESQLDKLTIRMLSELGLTACADAMIGGRLLKGVSGGERKRTSVGVELVVKPALVFLDEPTSGLDSFSAVQLCQVLKKVANAGASVLFTIHQPSSVIFSSFDHLLVMNKGRLMYTGSVQDVPSYFANRGHPNPP

HMMPanther: PTHR19241
1-512 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

RKLLDNVWGEVPPKQTTAVMGPSGAGKTSLLNILAGRARTHGQISIGKDIRLNNYSVDPTKMKVRQMIAFVAQDDSLQETATPREAIRFSAKLRLPRATTESQLDKLTIRMLSELGLTACADAMIGGRLLKGVSGGERKRTSVGVELVVKPALVFLDEPTSGLDSFSAVQLCQVLKKVANAGASVLFTIHQPSSVIFSSFDHLLVMNKGRLMYTGSVQDVPSYFANRGHPNPPNYNPADFIMDVAQSIPVEQLTREGFFPADERKMADPFEPEEGQDALGITVTRHTYRGVDMYDGSPPGLLTEIRLLFQREVNNLKRDTSALKARFSLSLVVGLIVGVIFWKVGETDSSVSTNLQSHFGAVILVSLMSMFETAQPALFAFPAERPVFLREYSTNHYSAASYFLSHSVLAHQISLLFLPEQCIITYFMIDFQLNFGMLFAVLYVLAMASTALAVLLGCSVEDPKVAQEMLSIIFVPQMLFSGFFVTIELIPAWLRWLRYIFPLTYAIRIILV

Gene3D: G3DSA:3.40.50.300
2-245 G3DSA:3.40.50.300

KLLDNVWGEVPPKQTTAVMGPSGAGKTSLLNILAGRARTHGQISIGKDIRLNNYSVDPTKMKVRQMIAFVAQDDSLQETATPREAIRFSAKLRLPRATTESQLDKLTIRMLSELGLTACADAMIGGRLLKGVSGGERKRTSVGVELVVKPALVFLDEPTSGLDSFSAVQLCQVLKKVANAGASVLFTIHQPSSVIFSSFDHLLVMNKGRLMYTGSVQDVPSYFANRGHPNPPNYNPADFIMDVA

HMMSmart: SM00382
IPR003593
13-210 AAA,NBS
ATPase, AAA+ type, core

PKQTTAVMGPSGAGKTSLLNILAGRARTHGQISIGKDIRLNNYSVDPTKMKVRQMIAFVAQDDSLQETATPREAIRFSAKLRLPRATTESQLDKLTIRMLSELGLTACADAMIGGRLLKGVSGGERKRTSVGVELVVKPALVFLDEPTSGLDSFSAVQLCQVLKKVANAGASVLFTIHQPSSVIFSSFDHLLVMNKGR

HMMPfam: PF00005
IPR003439
28-161 ABC_tran
ABC transporter-like

TSLLNILAGRARTHGQISIGKDIRLNNYSVDPTKMKVRQMIAFVAQDDSLQETATPREAIRFSAKLRLPRATTESQLDKLTIRMLSELGLTACADAMIGGRLLKGVSGGERKRTSVGVELVVKPALVFLDEPTS

HMMPfam: PF01061
IPR013525
304-512 ABC2_membrane
ABC-2 type transporter

EIRLLFQREVNNLKRDTSALKARFSLSLVVGLIVGVIFWKVGETDSSVSTNLQSHFGAVILVSLMSMFETAQPALFAFPAERPVFLREYSTNHYSAASYFLSHSVLAHQISLLFLPEQCIITYFMIDFQLNFGMLFAVLYVLAMASTALAVLLGCSVEDPKVAQEMLSIIFVPQMLFSGFFVTIELIPAWLRWLRYIFPLTYAIRIILV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox