PRGDB00080737 (Ptc.17485)

From PRG Wiki
Jump to: navigation, search
Ptc.17485
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 187012223 (CU715012)
Gene Class Unknown
Domain Type
Gene Species Dimocarpus longan

Comment?

CU715012 Phaeodactylum tricornutum Aerated culture of predominantly triradiate cells Phaeodactylum tricornutum cDNA clone KS0ASA21YK11 5', mRNA sequence

DNA Sequence

TCAAGGGTATTTCCGGAGGCGAGCGCAAACGAACGAGTGTCGGCATTGAGCTCGTTACACAACCGACGATTGTCTTTTTGGACGAACCAACATCGGGTCTGGACAGCTTTTCGGCACTGCAGTTGGTACAGGTCTTGCGCAAAGTAGCGGCAGCTGGTGCCAGTGTCCTCTTTACTATTCACCAACCACAGTCTGATATCTTTGATTTGTTTGATAGTCTGATTATAATGAACAAAGGAGAAATCATGTATCAAGGTAGCGCTGAAGGCGTGACGGATCACTTTGAAGCTCGTGGTTACGCACTACCTCGCAAATACAATCCTGCTGATTACATAATGACTGTGACGCAAACTGTCCCTGTCACCGATCTCAGGAAAGCCGGGTTTTTTAAGGTGTCGGATCAAAATATGCAAGAGTCGGCATCTTCGGAACAATCGGCTTCTCAGCATCGTGTTGTATCGAAGAGCGGTCGCTCGGCAGCACTCGTGGGAACATTGACCCAGATTCGCTACCTTATGCTCCGTGATTTTCAGGCTTTGGTCCGTGTCAAGAAAATTCTTGGTGCCCGTCTCGCTCTAACTACCTTTATGGGCGTCTTGACAGGTTTCATCTTTTTGCGTGTCGGTGACAACGACATGTCAGATCTAGTGAATACACAATCGATGTTTGGGGCAGTGGTAATCACCAACATGATTGCCATGTTCGGTACCCCATTGCCGACGCTGATTGTCTTTCCGGAAGAAGGGCCGGTTTTCTGCGCGAGTAAGCAACCAATCACTAATCTGTCTTTTCCTACTTTTTGGCCGGGTGAGCGCGGGGACCCTTTTGACCTTTGTCCAATTTATTGTTTCTCGCGTTCCTGGAGtttttttttCCTGGGCTTACACCCTGGCCTTTGGGAAATGCTTTTTCGTGAACTTTGTTCCCTTGGCCAAGGTGACGGGATGGCGCAGAATATGTGGTACATTGGTTGCGACGCTCAAAAATCCCGCAAAAGGGTGTGTAGGATTGTCCTGCAATAGAACTTTGTGTGCCAAGAAATTTGAATATTTGAGATTTTTGATGTTGGGCCCAGATAAATATTGTTTACACATTTTTGACACCCCATATGCGCTCAAAAGAAATGAGAAGGACTGTTTGGAAATTAAGCCACGTAAGATACAAGTGGTGAAATTAGATAGAGGAGACAAATATTAGACTCGCCCAGCCGGTCATACTTGCAATATATGTTGCGGGGTTGAAAGCGTTAACAATGACGCC


Protein sequences

Name Description Sequence
Ptc.17485 translated coding region predicted by ESTScan from UniGene Ptc.17485

XKGISGGERKRTSVGIELVTQPTIVFLDEPTSGLDSFSALQLVQVLRKVAAAGASVLFTIHQPQSDIFDLFDSLIIMNKGEIMYQGSAEGVTDHFEARGYALPRKYNPADYIMTVTQTVPVTDLRKAGFFKVSDQNMQESASSEQSASQHRVVSKSGRSAALVGTLTQIRYLMLRDFQALVRVKKILGARLALTTFMGVLTGFIFLRVGDNDMSDLVNTQSMFGAVVITNMIAMFGTPLPTLIVFPEEGPVFCASKQPITNLSFPTFWPGERGDPFDLCPIYCFSRSWSFFFLGLHPGLWEMLFRELCSLGQGDGMAQNMWYIGCDAQKSRKRVCRIVLQ


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
2-129 P-loop containing nucleoside triphosphate hydrolases

KGISGGERKRTSVGIELVTQPTIVFLDEPTSGLDSFSALQLVQVLRKVAAAGASVLFTIHQPQSDIFDLFDSLIIMNKGEIMYQGSAEGVTDHFEARGYALPRKYNPADYIMTVTQTVPVTDLRKAGF

HMMPanther: PTHR19241
2-252 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

KGISGGERKRTSVGIELVTQPTIVFLDEPTSGLDSFSALQLVQVLRKVAAAGASVLFTIHQPQSDIFDLFDSLIIMNKGEIMYQGSAEGVTDHFEARGYALPRKYNPADYIMTVTQTVPVTDLRKAGFFKVSDQNMQESASSEQSASQHRVVSKSGRSAALVGTLTQIRYLMLRDFQALVRVKKILGARLALTTFMGVLTGFIFLRVGDNDMSDLVNTQSMFGAVVITNMIAMFGTPLPTLIVFPEEGPVF

Gene3D: G3DSA:3.40.50.300
3-116 no description

GISGGERKRTSVGIELVTQPTIVFLDEPTSGLDSFSALQLVQVLRKVAAAGASVLFTIHQPQSDIFDLFDSLIIMNKGEIMYQGSAEGVTDHFEARGYALPRKYNPADYIMTVT

Seg: seg
138-149 seg

QESASSEQSASQ

HMMPfam: PF01061
IPR013525
167-242 ABC2_membrane
ABC-2 type transporter

TQIRYLMLRDFQALVRVKKILGARLALTTFMGVLTGFIFLRVGDNDMSDLVNTQSMFGAVVITNMIAMFGTPLPTL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox