PRGDB00080740 (Ptc.17559)

From PRG Wiki
Jump to: navigation, search
Ptc.17559
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 187012511 (CU715924)
Gene Class N
Domain Type NBS
Gene Species Dimocarpus longan

Comment?

CU715924 Phaeodactylum tricornutum Aerated culture of predominantly triradiate cells Phaeodactylum tricornutum cDNA clone KS0ASA1YB12 5', mRNA sequence

DNA Sequence

CGACAACAAACACAGCATTACAGCATCCAGGAAGCGAAATGGATATGGGATCTACTGCGGTGAACAAGATCCTCGACAAGAACGAAATGTCAGGACCATTCCAAAGTCGACAAGGGAAGAGCCTGAAATGGAGTAACGTTAACATGACGTTGGTGGCGAAAGGCAAGAGCCCGGAAAAGAAAATTTTACAAAATGTTTGGGGCGAAGCTGGCAACGAAACGACAGCAATTATGGGACCCTCTGGGTCAGGAAAAACCTCCCTATTGAACGTCCTGTCGGGGAGGGCTCGAAACCTTGGGCGGTTGAAAGTCACTGCTGATGTTAAGCTGGACGGCAAGTCCGTCGACCCGACTGATGTGTCAGTTCGTCAGCACATTGCCTTTGTAGAGCAAGACGACACCCTTTGCATATCAGCCACGCCTAGGGAAGCCATTTTCTTTTCTGCCAAGTTACGCTTGCCCAAAAGCTACATGGACGAACAATTGCATACACTGACGGACCGTATGCTAACAGAGCTTGGTCTCCAAGGTTGTGCCGATACGATCATTGGAGGAACGCTGACGAAGGGTATATCTGGGGGCGAGCGCAAGCGCACCAGCGTCGGAGTCGAGCTCGTGACGCAACCATCTATCGTATTCCTAGACGAGCCAACATCTGGACTTGATAGCTTTTCTGCATTACAGCTTGTTCAGGTTTTGACAAAGTGGCTAGAGCAGGAGCCAGCCGTCTCTTTACCATCCATCAGCCTCAGTCAGACATCTTTTGACTGTTTGATTGAATGAATCTAATGGAATAAGGGCAAGTCATGTACCAGGGTGATGTTGAAAACATTACGGACTATTTTGAGTTCCGTGGAACCCCTCTTCCACCAAATAAAACCCTGGGGAACAAGTGAGATTGGCCGCCAGACCCCTTCCaaaaaaaaaaattaaaaaggaaggctttttccccaaaaaaaaaaGGGCTGATTTTTAGTTCTGAAACAACTCCTTTTGGAAAAACATCCCaaaaaaaaagaaccaaaaaaaaaCGTTTGGGGACCCGGGAACCCGGGGAAAAATATTTTGGTGCCACGGGGTTTTTTTAGGAACCTTGTGTAGGGAATTAATAAATAATTTTTGTGGGccccccgcccccctccctgacccgggattttttttttttttgtttttatattttgttttattattcttttttGGGGCAAAGATAAGGCCACAAGAAAAAACACTTTTTTTGTGAGATTGTTGGGGGGAGGAGAAGGTCGGCAAACAACCACTTCttttttttttGTGTGTTTGTGTGTCTCTTTCCTATCCCCT


Protein sequences

Name Description Sequence
Ptc.17559 translated coding region predicted by ESTScan from UniGene Ptc.17559

XTTNTALQHPGSEMDMGSTAVNKILDKNEMSGPFQSRQGKSLKWSNVNMTLVAKGKSPEKKILQNVWGEAGNETTAIMGPSGSGKTSLLNVLSGRARNLGRLKVTADVKLDGKSVDPTDVSVRQHIAFVEQDDTLCISATPREAIFFSAKLRLPKSYMDEQLHTLTDRMLTELGLQGCADTIIGGTLTKGISGGERKRTSVGVELVTQPSIVFLDEPTSGLDSFSALQLVQVLTKWLEQEPAVSLPSISLSQTSFDCLIE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
35-233 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

QSRQGKSLKWSNVNMTLVAKGKSPEKKILQNVWGEAGNETTAIMGPSGSGKTSLLNVLSGRARNLGRLKVTADVKLDGKSVDPTDVSVRQHIAFVEQDDTLCISATPREAIFFSAKLRLPKSYMDEQLHTLTDRMLTELGLQGCADTIIGGTLTKGISGGERKRTSVGVELVTQPSIVFLDEPTSGLDSFSALQLVQVL

Gene3D: G3DSA:3.40.50.300
40-239 no description

KSLKWSNVNMTLVAKGKSPEKKILQNVWGEAGNETTAIMGPSGSGKTSLLNVLSGRARNLGRLKVTADVKLDGKSVDPTDVSVRQHIAFVEQDDTLCISATPREAIFFSAKLRLPKSYMDEQLHTLTDRMLTELGLQGCADTIIGGTLTKGISGGERKRTSVGVELVTQPSIVFLDEPTSGLDSFSALQLVQVLTKWLEQ

superfamily: SSF52540
49-238 P-loop containing nucleoside triphosphate hydrolases

MTLVAKGKSPEKKILQNVWGEAGNETTAIMGPSGSGKTSLLNVLSGRARNLGRLKVTADVKLDGKSVDPTDVSVRQHIAFVEQDDTLCISATPREAIFFSAKLRLPKSYMDEQLHTLTDRMLTELGLQGCADTIIGGTLTKGISGGERKRTSVGVELVTQPSIVFLDEPTSGLDSFSALQLVQVLTKWLE

HMMSmart: SM00382
IPR003593
71-260 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

GNETTAIMGPSGSGKTSLLNVLSGRARNLGRLKVTADVKLDGKSVDPTDVSVRQHIAFVEQDDTLCISATPREAIFFSAKLRLPKSYMDEQLHTLTDRMLTELGLQGCADTIIGGTLTKGISGGERKRTSVGVELVTQPSIVFLDEPTSGLDSFSALQLVQVLTKWLEQEPAVSLPSISLSQTSFDCLIE

HMMPfam: PF00005
IPR003439
86-219 ABC_tran
ABC transporter-like

TSLLNVLSGRARNLGRLKVTADVKLDGKSVDPTDVSVRQHIAFVEQDDTLCISATPREAIFFSAKLRLPKSYMDEQLHTLTDRMLTELGLQGCADTIIGGTLTKGISGGERKRTSVGVELVTQPSIVFLDEPTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox