PRGDB00080741 (Ptc.17741)

From PRG Wiki
Jump to: navigation, search
Ptc.17741
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219128186 (XM_002184264)
Gene Class Unknown
Domain Type LRR
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

CGAAGTTTGTTTTCGTTCTCTTGCTGTTTTCCGTTACACTTGCTTTCCTACGCCAGTCTTCGTGATCTGTCGTTCCATTCTGAGTACAAGCCCATAAGATGCGCGGTATCTTCTTCGCAGCATCCACGCTGGTTCTCGGCATCGCTTCCTTTCGGGCGACCGATGCCCAGGACGTCAGCTGCCAGTTGGTTCGTCAACCCAATGGCAGCGTTGAATACGTATGTGACCAAGTAAGGGAGCCAATGCGGCCTCCCCTCGTCCCAGACGGCCAAACCTATCAACAAGGCCCGGTAGAAAAGTACTACCTTCAACAACCGGCGGAAGATGTGAATGCATCGGCAAACGCTACCATTCCAATCTTACGTCGTGTAGGCGTCCCGCCATTTGATACTCCTCTACAGGCTTGCCAAGGAAGCTGTGGAAGTGACGCAGATTGCGCGACTGGACTCGTGTGTCTTGATCAGTTGGATCGGCCGCGAGATGGAAGCGTCCAAGGATGTTCCGGTAACGGTCGCCTGACTATGAGCGTGTGTGTGGTACCGGGTTCGGAAGTTGATCTCAAGATTGGATCGTTGTCGTTAGAAAAGTGCCAGGGGACCTGTTCTTCAGACGATGATTGTGCTGGTGGCCTCGCTTGTTTCCGGCGCCAAGGAACGGAAACCGTACCAGGTTGTCTCGAACGTGATGTGAGCGAGTCTAACTTCTGCCATGATCCCAACGAAACCTTGGCAAGATTAGCTTTCGTGGGTGCGGCCCCTCACTCACAGTCATCGCTACTTCCTACATGCTCTGGATCCTGTTCATCAGATTGGGACTGCGTTCGCGGCAGTAATTGCTTTCGTCGAGATGGCACGGAATCCGTTCCTGGATGTGAAGGAAGAGGACTCAGTGGAGCCAATTATTGTTACATTGCTCCGGAGGGGTCTTTGCTTCTGGTCGGCGATGGTGTAACATACATACAATATCCATTGAGACAATGCGAAGGACATTGTATTGCCGATATCGATTGCGAAAGTGGTTTGAAATGCTTTCGACGCGAAGGTTCGGAACATATTCCTGGTTGTGACGGAGAGGGCGCGGATCGAACCAACTACTGTTACCAACCATTTCCGGATACTTCCGGTCCAACGGATGGCCCTACACTGGCACCGCTTTCAGTCTCCCCATCCAATTCTCCTTCTTTAATCCTAACGCTTGATCCCACCAATAGCTTGGGATCTCGAGGTGGCGAATCCGAGTCCCCTTCGACACCGACATCAGATATGCCGTCGATATCACCATCAGATGAACCTTCAATGATACCTTCTGATACGCCGTCAATGGTACCGTCTGACGTGCCTTCGATGCTGCCGTCCGACGCACCCTCGATGATTCCATCTGATAGTCCCTCAGACACGCCATCTGATGTTCCTTCGGACGTGCCTTCGGTGTTGCCCTCTTTTTCACCTTCTATGAGGCCTTCTGATACTCCTTCGACAATGCCATCGGATACTCCTACCGACGTCCCCTCAGATGCCCCCTCTGATTCACCGTCAGATGTTCCCTCCGACGTTCCATCAGATGCACCTTCTGATGTTCCCTCCGACGTCCCTTCAGATGCACCTTCTGACGTCCCTTCAGATACCCCCTCTGATGTTCCCTCTGACGTCCCTTCAGATACCCCTTCTGATGTCCCCTCTGACGTCCCTTCAGATACACCTTCTGCCGTACCCTCTGATGTCCCTTCAGGTAACCCTTCTGACGTCCCTTCAGAAACCCCCTCTGACGTCCCTTCAGATACCCCTTCTGATGTTCCCTCTGACGTTCCCTCTGACGTTCCCTCTGATGTCCCCTCCGACGTCCCTTCAGATGTGCCCTCTGACGTCCCTTCAGATACCCCTTCTGATGTTCCCTCTGATGTCCCTTCTGATACTCCCTCCGATCTCCCATCCGACGTGCCGTCTGATGTACCGTCCACGATGCCGTCTTCTACGTTAGGTGGTACCTCATCTAATGGGCCAGTAACGGGAAAGGGCAGTCTAGCACCAACCGGTAGCTTTTCGGGTGAGTCGAGTGGAAGGCCTTCTAAGACTCCTGGTGTGATGGTTGAATTGAGCGCAAGGCCAAGCGAGTCTTTTACCCCATCTCCGACTACTTTCCCAGTACTCCTTCCTTCAAAAGTACCGTCAATAGCTCCATCTCGCACTGAGACCGTTGCTCCGAGCACAGCCTTCCCCACTGAGACTTCGTCATCACTGCCCACTTTGACTACGACTGTGTCTTCAGCTCCGACACAAATGTGCAGTATGTCCGCATCAGAGCGCGCAAGCACCATCATGGGAATTTTGGAAGAGGACTTTAACGATGTGAGCAGTCCTCAGTTCCGGGCGGTGGAGTGGTTGGTGCAAATAGATCCTCTTTCGCTTTGCCCAGGAGATGAGAACTTGGAGCAACGATACATTTTGGCTGTGCTGTATTTCCAAACCGGTGGAGAATGGTGGACACGATGTTCACCTATGAGTGCTGAAGTTTGCGACCAGGGTGAAGCTTTTTTGAGTGGCGCAAATGAATGTGCCTGGGGTGGAGTCAATTGCGATTCTTCGAGTCGTGTGACGGCTCTTCACTTGGATTCAAACAACTTATCGGGTAGTTTGCCCAGCGAGTTGGGTCGTTTGGCATATTTGGTCGAACTGGACATGGACGACAACGAGCTGACGGGTTCCATACCGCGGATTCTGGGACAGCTTTCTTTTTTGGAAATTGTTGACCTGGACGACAACCAATTGACGGGAAGCATCCCGGAAGAATTGTACAGTGTCAGCTCGCTGGAGATTTTGGATCTGGATATTAACCAATTGACAGGAACTATTTCTACCCTCATTGGCAATCTGGTAAATCTGTACTATTTGCAGATTGACTCGAACAAATTTACGGGCAGCATACCGTCCGAGGTGGGCACTCTGACTCGTCTCGAATACTTCTCCATGACCGATATTCAAATAGCCGAGGCTCTACCCGACTCGTTATGCAGCCGCGATACCTTGCTTTTGTTCGGAGATTGTGAGGTTTGTGTGGTAGAAGACTGCTGCACCGCTTGTCTCGCCAAGGAGACAACTCCGTAA


Protein sequences

Name Description Sequence
Ptc.17741 translated coding region predicted by ESTScan from UniGene Ptc.17741

MRGIFFAASTLVLGIASFRATDAQDVSCQLVRQPNGSVEYVCDQVREPMRPPLVPDGQTYQQGPVEKYYLQQPAEDVNASANATIPILRRVGVPPFDTPLQACQGSCGSDADCATGLVCLDQLDRPRDGSVQGCSGNGRLTMSVCVVPGSEVDLKIGSLSLEKCQGTCSSDDDCAGGLACFRRQGTETVPGCLERDVSESNFCHDPNETLARLAFVGAAPHSQSSLLPTCSGSCSSDWDCVRGSNCFRRDGTESVPGCEGRGLSGANYCYIAPEGSLLLVGDGVTYIQYPLRQCEGHCIADIDCESGLKCFRREGSEHIPGCDGEGADRTNYCYQPFPDTSGPTDGPTLAPLSVSPSNSPSLILTLDPTNSLGSRGGESESPSTPTSDMPSISPSDEPSMIPSDTPSMVPSDVPSMLPSDAPSMIPSDSPSDTPSDVPSDVPSVLPSFSPSMRPSDTPSTMPSDTPTDVPSDAPSDSPSDVPSDVPSDAPSDVPSDVPSDAPSDVPSDTPSDVPSDVPSDTPSDVPSDVPSDTPSAVPSDVPSGNPSDVPSETPSDVPSDTPSDVPSDVPSDVPSDVPSDVPSDVPSDVPSDTPSDVPSDVPSDTPSDLPSDVPSDVPSTMPSSTLGGTSSNGPVTGKGSLAPTGSFSGESSGRPSKTPGVMVELSARPSESFTPSPTTFPVLLPSKVPSIAPSRTETVAPSTAFPTETSSSLPTLTTTVSSAPTQMCSMSASERASTIMGILEEDFNDVSSPQFRAVEWLVQIDPLSLCPGDENLEQRYILAVLYFQTGGEWWTRCSPMSAEVCDQGEAFLSGANECAWGGVNCDSSSRVTALHLDSNNLSGSLPSELGRLAYLVELDMDDNELTGSIPRILGQLSFLEIVDLDDNQLTGSIPEELYSVSSLEILDLDINQLTGTISTLIGNLVNLYYLQIDSNKFTGSIPSEVGTLTRLEYFSMTDIQIAEALPDSLCSRDTLLLFGDCEVCVVEDCCTACLAKETTP

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
801-975 SSF52058,LRR

SAEVCDQGEAFLSGANECAWGGVNCDSSSRVTALHLDSNNLSGSLPSELGRLAYLVELDMDDNELTGSIPRILGQLSFLEIVDLDDNQLTGSIPEELYSVSSLEILDLDINQLTGTISTLIGNLVNLYYLQIDSNKFTGSIPSEVGTLTRLEYFSMTDIQIAEALPDSLCSRDTL

Gene3D: G3DSA:3.80.10.10
816-974 G3DSA:3.80.10.10

NECAWGGVNCDSSSRVTALHLDSNNLSGSLPSELGRLAYLVELDMDDNELTGSIPRILGQLSFLEIVDLDDNQLTGSIPEELYSVSSLEILDLDINQLTGTISTLIGNLVNLYYLQIDSNKFTGSIPSEVGTLTRLEYFSMTDIQIAEALPDSLCSRDT

HMMPanther: PTHR24420:SF474
818-975 PTHR24420:SF474,SUBFAMILY NOT NAMED

CAWGGVNCDSSSRVTALHLDSNNLSGSLPSELGRLAYLVELDMDDNELTGSIPRILGQLSFLEIVDLDDNQLTGSIPEELYSVSSLEILDLDINQLTGTISTLIGNLVNLYYLQIDSNKFTGSIPSEVGTLTRLEYFSMTDIQIAEALPDSLCSRDTL

HMMPanther: PTHR24420
818-975 PTHR24420,FAMILY NOT NAMED

CAWGGVNCDSSSRVTALHLDSNNLSGSLPSELGRLAYLVELDMDDNELTGSIPRILGQLSFLEIVDLDDNQLTGSIPEELYSVSSLEILDLDINQLTGTISTLIGNLVNLYYLQIDSNKFTGSIPSEVGTLTRLEYFSMTDIQIAEALPDSLCSRDTL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox