PRGDB00080742 (Ptc.17871)

From PRG Wiki
Jump to: navigation, search
Ptc.17871
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219122936 (XM_002181756)
Gene Class N
Domain Type NBS
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

ATGCAACGCCCCATTATCCAAGATGTTTCGTTGTGCTTGCAGCCGGGCAAAAATTATCTCGTATTGGGGCCTCCCGCTTCGGGCAAGTCAACCTTGCTCAAAGCGATCGCGGGGCAGCTGAAATCATCGTCGACGGAAAAACTGGAAGGCCAGATACTGTATAATGGACGGGAGTTGGAGCAGTGGTACATTGAAAATGCCTTTGCTTACATTGATCAACTAGACAAGCACGCACCACGGTTGACGGTCGACGAGACGTTCGAATTTTCTTTTCAATGTAAAACCGGAGGCACATTTCAGCAAGCTCAGGATCCACGCGTTTTGCAGGACCCCAAAGTTATGACAGCGATACAAGAAGCCGACCGGAGCAGACTCGGTGTGAATATGGTCTTGGCGAGTCTAGGGTTGACGGAAGTTCGCGATACGTTTGTGGGGAACACTGCCGTTCGTGGGGTTAGTGGAGGCCAACGGCGGCGAGTGACCGTGGGGGAAATGATTACGTCTCGTCAACCTGTCCTTTGCGGTGACGAAATTTCGACTGGTTTGGATGCTGCGTCCACCTTTGACATGGTGCAAGTACTCACTCACTTTGGAAAACTAGCGCAAATGACACGAGTCTTTGCTCTGCTGCAGCCGAGTCCCGAGACTTTCAGTCTTTTCGACGAGATCATACTCGTGTCGGAAGGCTTGATTTTGTATGCTGGACCAATCGACGAGGTAGAGGATTACTTCGCTGAGCTTGGCTATCGATCTCCACAGTTCATGGATGTCGCTGACTTTCTACAAACGGTTTCTACCGAGGACGGTAAGAAACTGTATCACCCTCATGGAAGCATTGTCTCGCAGCTTACCTTGTTGAAGCAAGTGAAGAAAAAGTACGCCAACTCCTTCTTTCGAAATACGTGGTTGAATCTGAAACGATTCTTGTTGTTGTGGACGAGGGATAAAAGAGTGATTTTCGCCAGTGCAGTCAAGAACATATTGATGGGTGTCAGTGTTGGCGGAGTATTCCGCGACGTCGATGACGAAGTCTCTATTTTAGGGGCTCTTTTTCAATCAGGTCTTTTTATCATGCTCGGGGCAATGCAAAGTGCATCTGGGCTAGTAAACGACCGCGTTATCTTTTATAAGCAAATGGACGCCAATTTCTTCTCGTCGTGGCCCTACACGCTGGGAAGAACTTTGGCAGGATTCCCACAGACCATCATGGATGTCTTCACGTTTGGGACAATTCTTTACTTTATGGTTGGACTTAGCGATCGAGCTGTGACCGAATATTTCTTGTTTATTGCAATTTTAATGACTTTTGCAATGATGATGAATATGCAGCTAGCAGTGTTTGCATCGTTCGCTCCAGACTCTCAGCTGCAAGTCTACAGTGCTTGTACACTACTGCTGCTAATTCTGTTCGGTGGTTACATTGTGGCGCCTGATGCCATCCCCTCGTTTTATCTTTGGATATATTGGTGGAATCCTTTTGCTTGGGCTTATCGTGCTTTGGTGATCAATGAGTTTCGTAGTTCACGATGGGATGATCCAGACGCGACGCTTGCAGGGATTGGTTTCGTGTACGGTATAGATTCTAGGCCATTTGAACAGGACTGGCTGGGGTATTGCTTCCTTTATATGACCATTTACTTTTTCGGTTGCGTAGTTCTGACGGCTGTGAGTCTTGGCTACCGTCGGAGGGTCAATGTACCCTTTAAACCTGTGACATTGTCTTTTGCAGACGTTTGCTACGAAGTCAAAGCTTCAACAAAAAATGAAACTCTAAAACTTTTGAATGGTGTCAATGGAATTTTCCGATCAGGACGCATGTGCGCATTGATGGGATCGAGTGGAGCAGGCAAAACGACATTGCTGGATGTGATTGCTCTAAGAAAAAGGACTGGATCAGTGACGGGTGACGTTCGGTTGAATGGATGGTCACAGGACAAAATCTCGTTTTGTCGTTGCTCTGGATACGTTGAGCAATTTGACGTCCAGTCACCGGAGCTGACGGTTCGGGAGACAATTCTGTTCTCTGCTCGGCTCCGCCTCGATCGCGATGTCGTCACAAGCGAAGAGGACCGGGAGGCTTTCGTCGACCAAGTCATTGACGATATGGAACTTCTTCCTTTGGCTGATTCGTTAGTTGGTAGTGACGAGGGAATCGGTCTAAGTTTTGAGCAAAAGAAGAGGTTATCAATTGCGGTTGAACTCGCGGCTTCACCGTCTGTCGTCTTCCTGGATGAGCCTACGAGTGGTTTAGACGCCCGAAGCGCTCTACTTGTGGTAAGGGCGCTACGCAATATTTCAGACAAAGGGCAAACCATCGTCGCAACTATTCATCAACCATCGTCAGCGATTTTTGAGATGTTTGACGAATTGTTGTTGTTGAAACGAGGTGGGCAGGTTGTTTTTCAAGGAGACTTGGGAAAAGATTGCTCGCGTTTAGTGAACTATTTTGAAAATTTGGGGGCAACAAAGATCGAACTCGGGGAAAATCCTGCGAACTGGATGCTTCGGGTAATTACATCGGAAGACATGGGTGATCTTGCGCAAAAGTACGTCGAGTCAAAGGAGTACGCACTCCTGCGTAAAGATCTGGATGAAATCAAGGCTGTCCAAGATCCCGAGTTAAAAATTGAGTACAAAGATGAATTTGCTGCCAGCAAGGCTGTACGACAGCTACTTGTCAACGGACGCCTACGCTTGATCTATTGGCGGTCACCAGCATACAATCTATCTCGCTTGATGGTATCTATGGTGATTGCCTTTGTTCTAGGATCGGTCTTTATTCTTGTCCGGCATCCAGAAATCTACACCGAAGTGGAGATGCGCTCCCGCCTGTCCGTAATCTTTCTAACGTTCATTATCACCGGTATCATGGCCATTCTTTCGGTAATCCCCGTCATGACCAAGATTCGGGAGATGTTTTATCGCCACCAAGATTCAGGAATGTACGATAGTGCCGCCATTGGTTGGGCCCTCGGTTCGGCTGAGAAGCTTTTCATTGTTCTGGCCACCACCATCTTTACGGTTGTCTTTTTGAGCGTAGCGGGTATGACCAAGTCGTTGCGTGGATTGTTTGGGTTTTGGGGATTCTTCACGTTCAACTTTGCGATATACTCCTACTTTGGACAGGCTTTCGTTTGTTTGGTTGAGAATCCTGCAACGGCATTAATTTTGTCGAGTGTCTTTATCGGCCTCAATAACTTCTTTGCCGGTTTAATTGTGCGTCCGCAACTGTTGGTTGGTTCGTTTTTTGCCTTTCCATTTTACATCACGCCCGGTCAATACGTCTACGAAGGTATGGTGACCAGTTTGTACAAGGGCAGTCCCAAAATTGTAACGGCCGATGTGGGCGGAGGCTTTTTCGAATACTTGGTGGACACGGGCGTGTGTGTTCCGCAACAGCCAGAGCCGTGTCAGGGGACCGTGTCCGACTTTATCGACGTCTTTTTCGGCGGCGTCTTTACGGACGATCATATTTCTCGCAACGCACTGATTCTGGGCGGTATATTGATCTTGACACGAGTCTTGACCTTTGCCGGTCTCAAGTACATTCGTTATAATTAGCTTACATAACCGAAAATACGTGAACACAGTG


Protein sequences

Name Description Sequence
Ptc.17871 translated coding region predicted by ESTScan from UniGene Ptc.17871

MQRPIIQDVSLCLQPGKNYLVLGPPASGKSTLLKAIAGQLKSSSTEKLEGQILYNGRELEQWYIENAFAYIDQLDKHAPRLTVDETFEFSFQCKTGGTFQQAQDPRVLQDPKVMTAIQEADRSRLGVNMVLASLGLTEVRDTFVGNTAVRGVSGGQRRRVTVGEMITSRQPVLCGDEISTGLDAASTFDMVQVLTHFGKLAQMTRVFALLQPSPETFSLFDEIILVSEGLILYAGPIDEVEDYFAELGYRSPQFMDVADFLQTVSTEDGKKLYHPHGSIVSQLTLLKQVKKKYANSFFRNTWLNLKRFLLLWTRDKRVIFASAVKNILMGVSVGGVFRDVDDEVSILGALFQSGLFIMLGAMQSASGLVNDRVIFYKQMDANFFSSWPYTLGRTLAGFPQTIMDVFTFGTILYFMVGLSDRAVTEYFLFIAILMTFAMMMNMQLAVFASFAPDSQLQVYSACTLLLLILFGGYIVAPDAIPSFYLWIYWWNPFAWAYRALVINEFRSSRWDDPDATLAGIGFVYGIDSRPFEQDWLGYCFLYMTIYFFGCVVLTAVSLGYRRRVNVPFKPVTLSFADVCYEVKASTKNETLKLLNGVNGIFRSGRMCALMGSSGAGKTTLLDVIALRKRTGSVTGDVRLNGWSQDKISFCRCSGYVEQFDVQSPELTVRETILFSARLRLDRDVVTSEEDREAFVDQVIDDMELLPLADSLVGSDEGIGLSFEQKKRLSIAVELAASPSVVFLDEPTSGLDARSALLVVRALRNISDKGQTIVATIHQPSSAIFEMFDELLLLKRGGQVVFQGDLGKDCSRLVNYFENLGATKIELGENPANWMLRVITSEDMGDLAQKYVESKEYALLRKDLDEIKAVQDPELKIEYKDEFAASKAVRQLLVNGRLRLIYWRSPAYNLSRLMVSMVIAFVLGSVFILVRHPEIYTEVEMRSRLSVIFLTFIITGIMAILSVIPVMTKIREMFYRHQDSGMYDSAAIGWALGSAEKLFIVLATTIFTVVFLSVAGMTKSLRGLFGFWGFFTFNFAIYSYFGQAFVCLVENPATALILSSVFIGLNNFFAGLIVRPQLLVGSFFAFPFYITPGQYVYEGMVTSLYKGSPKIVTADVGGGFFEYLVDTGVCVPQQPEPCQGTVSDFIDVFFGGVFTDDHISRNALILGGILILTRVLTFAGLKYIRYN

Domains

Domain Start-End Description Sequence

ProfileScan: PS50893
IPR003439
1-253 ABC_TRANSPORTER_2
ABC transporter-like

MQRPIIQDVSLCLQPGKNYLVLGPPASGKSTLLKAIAGQLKSSSTEKLEGQILYNGRELEQWYIENAFAYIDQLDKHAPRLTVDETFEFSFQCKTGGTFQQAQDPRVLQDPKVMTAIQEADRSRLGVNMVLASLGLTEVRDTFVGNTAVRGVSGGQRRRVTVGEMITSRQPVLCGDEISTGLDAASTFDMVQVLTHFGKLAQMTRVFALLQPSPETFSLFDEIILVSEGLILYAGPIDEVEDYFAELGYRSPQ

Gene3D: G3DSA:3.40.50.300
3-242 G3DSA:3.40.50.300

RPIIQDVSLCLQPGKNYLVLGPPASGKSTLLKAIAGQLKSSSTEKLEGQILYNGRELEQWYIENAFAYIDQLDKHAPRLTVDETFEFSFQCKTGGTFQQAQDPRVLQDPKVMTAIQEADRSRLGVNMVLASLGLTEVRDTFVGNTAVRGVSGGQRRRVTVGEMITSRQPVLCGDEISTGLDAASTFDMVQVLTHFGKLAQMTRVFALLQPSPETFSLFDEIILVSEGLILYAGPIDEVED

superfamily: SSF52540
3-246 SSF52540

RPIIQDVSLCLQPGKNYLVLGPPASGKSTLLKAIAGQLKSSSTEKLEGQILYNGRELEQWYIENAFAYIDQLDKHAPRLTVDETFEFSFQCKTGGTFQQAQDPRVLQDPKVMTAIQEADRSRLGVNMVLASLGLTEVRDTFVGNTAVRGVSGGQRRRVTVGEMITSRQPVLCGDEISTGLDAASTFDMVQVLTHFGKLAQMTRVFALLQPSPETFSLFDEIILVSEGLILYAGPIDEVEDYFAE

HMMSmart: SM00382
IPR003593
15-230 AAA,NBS
ATPase, AAA+ type, core

PGKNYLVLGPPASGKSTLLKAIAGQLKSSSTEKLEGQILYNGRELEQWYIENAFAYIDQLDKHAPRLTVDETFEFSFQCKTGGTFQQAQDPRVLQDPKVMTAIQEADRSRLGVNMVLASLGLTEVRDTFVGNTAVRGVSGGQRRRVTVGEMITSRQPVLCGDEISTGLDAASTFDMVQVLTHFGKLAQMTRVFALLQPSPETFSLFDEIILVSEGL

HMMPfam: PF00005
IPR003439
30-177 ABC_tran
ABC transporter-like

STLLKAIAGQLKSSSTEKLEGQILYNGRELEQWYIENAFAYIDQLDKHAPRLTVDETFEFSFQCKTGGTFQQAQDPRVLQDPKVMTAIQEADRSRLGVNMVLASLGLTEVRDTFVGNTAVRGVSGGQRRRVTVGEMITSRQPVLCGDE

PatternScan: PS00211
IPR017871
152-166 ABC_TRANSPORTER_1
ABC transporter, conserved site

VSGGQRRRVTVGEMI

HMMPanther: PTHR19241
181-1102 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

GLDAASTFDMVQVLTHFGKLAQMTRVFALLQPSPETFSLFDEIILVSEGLILYAGPIDEVEDYFAELGYRSPQFMDVADFLQTVSTEDGKKLYHPHGSIVSQLTLLKQVKKKYANSFFRNTWLNLKRFLLLWTRDKRVIFASAVKNILMGVSVGGVFRDVDDEVSILGALFQSGLFIMLGAMQSASGLVNDRVIFYKQMDANFFSSWPYTLGRTLAGFPQTIMDVFTFGTILYFMVGLSDRAVTEYFLFIAILMTFAMMMNMQLAVFASFAPDSQLQVYSACTLLLLILFGGYIVAPDAIPSFYLWIYWWNPFAWAYRALVINEFRSSRWDDPDATLAGIGFVYGIDSRPFEQDWLGYCFLYMTIYFFGCVVLTAVSLGYRRRVNVPFKPVTLSFADVCYEVKASTKNETLKLLNGVNGIFRSGRMCALMGSSGAGKTTLLDVIALRKRTGSVTGDVRLNGWSQDKISFCRCSGYVEQFDVQSPELTVRETILFSARLRLDRDVVTSEEDREAFVDQVIDDMELLPLADSLVGSDEGIGLSFEQKKRLSIAVELAASPSVVFLDEPTSGLDARSALLVVRALRNISDKGQTIVATIHQPSSAIFEMFDELLLLKRGGQVVFQGDLGKDCSRLVNYFENLGATKIELGENPANWMLRVITSEDMGDLAQKYVESKEYALLRKDLDEIKAVQDPELKIEYKDEFAASKAVRQLLVNGRLRLIYWRSPAYNLSRLMVSMVIAFVLGSVFILVRHPEIYTEVEMRSRLSVIFLTFIITGIMAILSVIPVMTKIREMFYRHQDSGMYDSAAIGWALGSAEKLFIVLATTIFTVVFLSVAGMTKSLRGLFGFWGFFTFNFAIYSYFGQAFVCLVENPATALILSSVFIGLNNFFAGLIVRPQLLVGSFFAFPFYITPGQYVYEGMVTS

HMMPanther: PTHR19241:SF10
181-1102 PTHR19241:SF10,ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDAASTFDMVQVLTHFGKLAQMTRVFALLQPSPETFSLFDEIILVSEGLILYAGPIDEVEDYFAELGYRSPQFMDVADFLQTVSTEDGKKLYHPHGSIVSQLTLLKQVKKKYANSFFRNTWLNLKRFLLLWTRDKRVIFASAVKNILMGVSVGGVFRDVDDEVSILGALFQSGLFIMLGAMQSASGLVNDRVIFYKQMDANFFSSWPYTLGRTLAGFPQTIMDVFTFGTILYFMVGLSDRAVTEYFLFIAILMTFAMMMNMQLAVFASFAPDSQLQVYSACTLLLLILFGGYIVAPDAIPSFYLWIYWWNPFAWAYRALVINEFRSSRWDDPDATLAGIGFVYGIDSRPFEQDWLGYCFLYMTIYFFGCVVLTAVSLGYRRRVNVPFKPVTLSFADVCYEVKASTKNETLKLLNGVNGIFRSGRMCALMGSSGAGKTTLLDVIALRKRTGSVTGDVRLNGWSQDKISFCRCSGYVEQFDVQSPELTVRETILFSARLRLDRDVVTSEEDREAFVDQVIDDMELLPLADSLVGSDEGIGLSFEQKKRLSIAVELAASPSVVFLDEPTSGLDARSALLVVRALRNISDKGQTIVATIHQPSSAIFEMFDELLLLKRGGQVVFQGDLGKDCSRLVNYFENLGATKIELGENPANWMLRVITSEDMGDLAQKYVESKEYALLRKDLDEIKAVQDPELKIEYKDEFAASKAVRQLLVNGRLRLIYWRSPAYNLSRLMVSMVIAFVLGSVFILVRHPEIYTEVEMRSRLSVIFLTFIITGIMAILSVIPVMTKIREMFYRHQDSGMYDSAAIGWALGSAEKLFIVLATTIFTVVFLSVAGMTKSLRGLFGFWGFFTFNFAIYSYFGQAFVCLVENPATALILSSVFIGLNNFFAGLIVRPQLLVGSFFAFPFYITPGQYVYEGMVTS

HMMPfam: PF01061
IPR013525
300-505 ABC2_membrane
ABC-2 type transporter

NTWLNLKRFLLLWTRDKRVIFASAVKNILMGVSVGGVFRDVDDEVSILGALFQSGLFIMLGAMQSASGLVNDRVIFYKQMDANFFSSWPYTLGRTLAGFPQTIMDVFTFGTILYFMVGLSDRAVTEYFLFIAILMTFAMMMNMQLAVFASFAPDSQLQVYSACTLLLLILFGGYIVAPDAIPSFYLWIYWWNPFAWAYRALVINEF

superfamily: SSF52540
552-807 SSF52540

VLTAVSLGYRRRVNVPFKPVTLSFADVCYEVKASTKNETLKLLNGVNGIFRSGRMCALMGSSGAGKTTLLDVIALRKRTGSVTGDVRLNGWSQDKISFCRCSGYVEQFDVQSPELTVRETILFSARLRLDRDVVTSEEDREAFVDQVIDDMELLPLADSLVGSDEGIGLSFEQKKRLSIAVELAASPSVVFLDEPTSGLDARSALLVVRALRNISDKGQTIVATIHQPSSAIFEMFDELLLLKRGGQVVFQGDLGK

Gene3D: G3DSA:3.40.50.300
573-804 G3DSA:3.40.50.300

LSFADVCYEVKASTKNETLKLLNGVNGIFRSGRMCALMGSSGAGKTTLLDVIALRKRTGSVTGDVRLNGWSQDKISFCRCSGYVEQFDVQSPELTVRETILFSARLRLDRDVVTSEEDREAFVDQVIDDMELLPLADSLVGSDEGIGLSFEQKKRLSIAVELAASPSVVFLDEPTSGLDARSALLVVRALRNISDKGQTIVATIHQPSSAIFEMFDELLLLKRGGQVVFQGD

ProfileScan: PS50893
IPR003439
573-821 ABC_TRANSPORTER_2
ABC transporter-like

LSFADVCYEVKASTKNETLKLLNGVNGIFRSGRMCALMGSSGAGKTTLLDVIALRKRTGSVTGDVRLNGWSQDKISFCRCSGYVEQFDVQSPELTVRETILFSARLRLDRDVVTSEEDREAFVDQVIDDMELLPLADSLVGSDEGIGLSFEQKKRLSIAVELAASPSVVFLDEPTSGLDARSALLVVRALRNISDKGQTIVATIHQPSSAIFEMFDELLLLKRGGQVVFQGDLGKDCSRLVNYFENLGA

HMMSmart: SM00382
IPR003593
603-797 AAA,NBS
ATPase, AAA+ type, core

SGRMCALMGSSGAGKTTLLDVIALRKRTGSVTGDVRLNGWSQDKISFCRCSGYVEQFDVQSPELTVRETILFSARLRLDRDVVTSEEDREAFVDQVIDDMELLPLADSLVGSDEGIGLSFEQKKRLSIAVELAASPSVVFLDEPTSGLDARSALLVVRALRNISDKGQTIVATIHQPSSAIFEMFDELLLLKRGG

HMMPfam: PF00005
IPR003439
618-748 ABC_tran
ABC transporter-like

TTLLDVIALRKRTGSVTGDVRLNGWSQDKISFCRCSGYVEQFDVQSPELTVRETILFSARLRLDRDVVTSEEDREAFVDQVIDDMELLPLADSLVGSDEGIGLSFEQKKRLSIAVELAASPSVVFLDEPTS

HMMPfam: PF01061
IPR013525
898-1103 ABC2_membrane
ABC-2 type transporter

RLIYWRSPAYNLSRLMVSMVIAFVLGSVFILVRHPEIYTEVEMRSRLSVIFLTFIITGIMAILSVIPVMTKIREMFYRHQDSGMYDSAAIGWALGSAEKLFIVLATTIFTVVFLSVAGMTKSLRGLFGFWGFFTFNFAIYSYFGQAFVCLVENPATALILSSVFIGLNNFFAGLIVRPQLLVGSFFAFPFYITPGQYVYEGMVTSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox