PRGDB00080744 (Ptc.18364)

From PRG Wiki
Jump to: navigation, search
Ptc.18364
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219130504 (XM_002185368)
Gene Class Unknown
Domain Type
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

CGCTGCTCACCAGGTGAGAGAAGATATCCAAGACTTTCAATCGAATCGTTAAGACTGTTGGAGTTCGCTGAATTCCATCGACTTGTACCAAAACTCTCAGCTTTTCTTCGACTTCCGCCGACTCTTTCGATACCGTTCTTTTTTCTATTCAGGTTTACAGTTATATCTAGCTAGAGACCATCACAATGATCATAAAAAATCAATTCGCGAAAGAACTACAACAATGTCACATACCAGCAAACAGTTTACGATCGATACCTCCAAACCCGTTGCGGTGACCGGAGCCACCGGATACATCGCCGGCGTCTTGGTGCAGCAGCTGCTCGAACAAGGAGTCACGATTCATGCATCTGTCCGCGATCCTAGCAAAAAGGACCACCTCCAGTACCTGCAAAATCTTGGCGAGAAGAACCCCGGAACGATCAAATTTTTCAAAGCGGATTTGCTGGAGGAAGGGAGTTTCGCCAAATGCTTTGATGGGTGCGAAATAGTCTTTCACACAGCGTCACCGTTTCAATTAAGCGTGGATGATCCTCAGAAGGACCTTATTGAGCCTGCTGTTAAGGGAACGAAGAACGTGCTGAATACAGTCAACAACACTCCTTCGGTCAAGCGTGTGGTACTCACCTCGTCAATTGCAGCGATTTATACCGACTCCTCCGAGTCCAAAAACAACCCTCTGAACGAAGAGACCTGGAATCGTACGGCAAGCTTAAAATACAAGCCGTACAATTTGAGCAAAACGTTGGCGGAACAAGTTGCGTGGGAGATGGCAGGTAGTCAGACTCAGTGGAAACTTGCAACGATAAACCCGTCCATGGTGTTGGGCCCTGGTGCGCGATTCCATCCTAGCTCCACGTCTTTCAAAATGATGAAGTCTCTCGGAGACGGAAGCATGAAGGCGTGTCCCAACAACGGTTTCGGTGTGGTCGACGTTCGCGAAGTGGCAACTGCACACATTGCTGCTGCGTACATTCCTGACGCCAAGGGGCGGCATATCCTCAACGCGGAAAACACAGGCTTCTACGAAATTGCGAAGGCTTTGCGCTCTCACTTCCCAAAGTACCCCATTCCTTCCTATAAAATGCCAAAAACATTGCTGTGGTTGATTGGGCCAACAATGGCGGGTACATCCCGTAAAGAAATATCCAATAATTGCGAGGTGATTCCGAATTTCGACCACACCAAATCTGTTCAAGAGCTAGGTATTAAGTATCGACCCGTCGCTAAGACAGCGGAAGACATGTTCCAACAGCTTGTTGATGAGGGCGTTGTCGGAAAGAAATAAATTACGAGGGATTGAACTGACCGTGAGTTCACTTACAGTCAAAATCATGGTTATATTTTTTGTGAAATTGTTTCCTCTGGAACGCAATTGAGCTTAACTATTTAGGTTTTTTATCTTACTC


Protein sequences

Name Description Sequence
Ptc.18364 translated coding region predicted by ESTScan from UniGene Ptc.18364

MSHTSKQFTIDTSKPVAVTGATGYIAGVLVQQLLEQGVTIHASVRDPSKKDHLQYLQNLGEKNPGTIKFFKADLLEEGSFAKCFDGCEIVFHTASPFQLSVDDPQKDLIEPAVKGTKNVLNTVNNTPSVKRVVLTSSIAAIYTDSSESKNNPLNEETWNRTASLKYKPYNLSKTLAEQVAWEMAGSQTQWKLATINPSMVLGPGARFHPSSTSFKMMKSLGDGSMKACPNNGFGVVDVREVATAHIAAAYIPDAKGRHILNAENTGFYEIAKALRSHFPKYPIPSYKMPKTLLWLIGPTMAGTSRKEISNNCEVIPNFDHTKSVQELGIKYRPVAKTAEDMFQQLVDEGVVGKK

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.720
IPR016040
13-279 NAD(P)-bd
NAD(P)-binding domain

SKPVAVTGATGYIAGVLVQQLLEQGVTIHASVRDPSKKDHLQYLQNLGEKNPGTIKFFKADLLEEGSFAKCFDGCEIVFHTASPFQLSVDDPQKDLIEPAVKGTKNVLNTVNNTPSVKRVVLTSSIAAIYTDSSESKNNPLNEETWNRTASLKYKPYNLSKTLAEQVAWEMAGSQTQWKLATINPSMVLGPGARFHPSSTSFKMMKSLGDGSMKACPNNGFGVVDVREVATAHIAAAYIPDAKGRHILNAENTGFYEIAKALRSHFP

superfamily: SSF51735
14-347 NAD(P)-bd

KPVAVTGATGYIAGVLVQQLLEQGVTIHASVRDPSKKDHLQYLQNLGEKNPGTIKFFKADLLEEGSFAKCFDGCEIVFHTASPFQLSVDDPQKDLIEPAVKGTKNVLNTVNNTPSVKRVVLTSSIAAIYTDSSESKNNPLNEETWNRTASLKYKPYNLSKTLAEQVAWEMAGSQTQWKLATINPSMVLGPGARFHPSSTSFKMMKSLGDGSMKACPNNGFGVVDVREVATAHIAAAYIPDAKGRHILNAENTGFYEIAKALRSHFPKYPIPSYKMPKTLLWLIGPTMAGTSRKEISNNCEVIPNFDHTKSVQELGIKYRPVAKTAEDMFQQLVD

HMMPanther: PTHR10366
16-349 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

VAVTGATGYIAGVLVQQLLEQGVTIHASVRDPSKKDHLQYLQNLGEKNPGTIKFFKADLLEEGSFAKCFDGCEIVFHTASPFQLSVDDPQKDLIEPAVKGTKNVLNTVNNTPSVKRVVLTSSIAAIYTDSSESKNNPLNEETWNRTASLKYKPYNLSKTLAEQVAWEMAGSQTQWKLATINPSMVLGPGARFHPSSTSFKMMKSLGDGSMKACPNNGFGVVDVREVATAHIAAAYIPDAKGRHILNAENTGFYEIAKALRSHFPKYPIPSYKMPKTLLWLIGPTMAGTSRKEISNNCEVIPNFDHTKSVQELGIKYRPVAKTAEDMFQQLVDEG

HMMPanther: PTHR10366:SF9
16-349 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

VAVTGATGYIAGVLVQQLLEQGVTIHASVRDPSKKDHLQYLQNLGEKNPGTIKFFKADLLEEGSFAKCFDGCEIVFHTASPFQLSVDDPQKDLIEPAVKGTKNVLNTVNNTPSVKRVVLTSSIAAIYTDSSESKNNPLNEETWNRTASLKYKPYNLSKTLAEQVAWEMAGSQTQWKLATINPSMVLGPGARFHPSSTSFKMMKSLGDGSMKACPNNGFGVVDVREVATAHIAAAYIPDAKGRHILNAENTGFYEIAKALRSHFPKYPIPSYKMPKTLLWLIGPTMAGTSRKEISNNCEVIPNFDHTKSVQELGIKYRPVAKTAEDMFQQLVDEG

HMMPfam: PF01370
IPR001509
16-258 Epimerase
NAD-dependent epimerase/dehydratase

VAVTGATGYIAGVLVQQLLEQGVTIHASVRDPSKKDHLQYLQNLGEKNPGTIKFFKADLLEEGSFAKCFDGCEIVFHTASPFQLSVDDPQKDLIEPAVKGTKNVLNTVNNTPSVKRVVLTSSIAAIYTDSSESKNNPLNEETWNRTASLKYKPYNLSKTLAEQVAWEMAGSQTQWKLATINPSMVLGPGARFHPSSTSFKMMKSLGDGSMKACPNNGFGVVDVREVATAHIAAAYIPDAKGRH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox