PRGDB00080747 (Ptc.19027)

From PRG Wiki
Jump to: navigation, search
Ptc.19027
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219124526 (XM_002182517)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Dimocarpus longan

Comment?

Phaeodactylum tricornutum CCAP 1055

DNA Sequence

GTCAACCAAGGGGACTACGATAAACGAACGGCTTTGCACTTGGCATCCGGCGAAGGACACGCATCGATCGTGCTGGCCCTTTGTGAGGCCGGCGCCGATCCCAACGTGGAAGATCGCTGGAAGCGACGTCCTCTCGATGACGCTTTTGCCGGCGGGACGGATGGAGCCTACGAAGAATGTGTCGCCATTCTCCAACGATTTGGTGCAGCCAGGGGCTTACAACGATCGACAACTTCCAACGTAAATCTAGAACTCGACAAATCCAGTAAGCGACAGAGCGACAATCTCAAAATTAATTTTGGTGAGCTCGAAATGATCGACCGCATTGGCGCTGGCGCGTTTGGAGAAATCTACAAATGCCGTTGGCGTGGCACCTTGGTAGCGGCAAAAATTATTAAAACGGCTAAGATTCGAAAAGAATGGAATGAACGAGACTTGGCCATTGCCGACTTTCACCAAGAAATATCGGTACTCAAGTCTCTAAGGCATCCACAGATTGTGCTCTTGCTCGCTTACTCAACCACAGCAGACTATGAAGTCATGATTTCCGAGCTCATGAAGTGTTCCTTGCTGGACGTATTCAAATCCCACATGGTCCAAGGAACGCGCATGCGGAAGCGAACCCAAATTATTTACGCGACACAGCTAGCACGCGGCATGAATTACTTGCACACGTGTAGCCCTCCCATCATTCATCGTGATCTCAAGCCTGCTAATTTGCTGATCGACCACAGCGGAGTATTGAAGATCTCCGACTTTGGCCTCTCCAAGATACGCCCCGATCCAGGAAAGAAAGAAACGGAAAAGTATACCATGACGGGTGAGACCGGTTCCTACCGCTTCATGGCTCCAGAAGTGTTTCGTCACGAAGAATACAACGAAACCGTCGACATTTATTCCTACGCCATGATTTTGTTCTATTTGCTCGTTGGGCGACCGCCGTGGCCTACCATTTCGGGTATGAATGCAGTCAAAAAGGCCGCCGAAGAAGGAGACCGACCTAACGTTCCTCGAGATATGGACTTGCGCATGCAAAGTCTACTCAAGGAATGCTGGGATGAGAATGCTTCAATGCGACCAGCCTTTCAACGTATTCTCGCCAATTTGGAA


Protein sequences

Name Description Sequence
Ptc.19027 translated coding region predicted by ESTScan from UniGene Ptc.19027

VNQGDYDKRTALHLASGEGHASIVLALCEAGADPNVEDRWKRRPLDDAFAGGTDGAYEECVAILQRFGAARGLQRSTTSNVNLELDKSSKRQSDNLKINFGELEMIDRIGAGAFGEIYKCRWRGTLVAAKIIKTAKIRKEWNERDLAIADFHQEISVLKSLRHPQIVLLLAYSTTADYEVMISELMKCSLLDVFKSHMVQGTRMRKRTQIIYATQLARGMNYLHTCSPPIIHRDLKPANLLIDHSGVLKISDFGLSKIRPDPGKKETEKYTMTGETGSYRFMAPEVFRHEEYNETVDIYSYAMILFYLLVGRPPWPTISGMNAVKKAAEEGDRPNVPRDMDLRMQSLLKECWDENASMRPAFQRILANLE

Domains

Domain Start-End Description Sequence

superfamily: SSF48403
IPR020683
1-71 ANK
Ankyrin repeat-containing domain

VNQGDYDKRTALHLASGEGHASIVLALCEAGADPNVEDRWKRRPLDDAFAGGTDGAYEECVAILQRFGAAR

ProfileScan: PS50297
IPR020683
1-76 ANK_REP_REGION
Ankyrin repeat-containing domain

VNQGDYDKRTALHLASGEGHASIVLALCEAGADPNVEDRWKRRPLDDAFAGGTDGAYEECVAILQRFGAARGLQRS

Gene3D: G3DSA:1.25.40.20
IPR020683
1-74 ANK
Ankyrin repeat-containing domain

VNQGDYDKRTALHLASGEGHASIVLALCEAGADPNVEDRWKRRPLDDAFAGGTDGAYEECVAILQRFGAARGLQ

HMMPanther: PTHR23257
1-370 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VNQGDYDKRTALHLASGEGHASIVLALCEAGADPNVEDRWKRRPLDDAFAGGTDGAYEECVAILQRFGAARGLQRSTTSNVNLELDKSSKRQSDNLKINFGELEMIDRIGAGAFGEIYKCRWRGTLVAAKIIKTAKIRKEWNERDLAIADFHQEISVLKSLRHPQIVLLLAYSTTADYEVMISELMKCSLLDVFKSHMVQGTRMRKRTQIIYATQLARGMNYLHTCSPPIIHRDLKPANLLIDHSGVLKISDFGLSKIRPDPGKKETEKYTMTGETGSYRFMAPEVFRHEEYNETVDIYSYAMILFYLLVGRPPWPTISGMNAVKKAAEEGDRPNVPRDMDLRMQSLLKECWDENASMRPAFQRILANLE

HMMPanther: PTHR23257:SF89
1-370 PTHR23257:SF89,ANKYRIN-KINASE

VNQGDYDKRTALHLASGEGHASIVLALCEAGADPNVEDRWKRRPLDDAFAGGTDGAYEECVAILQRFGAARGLQRSTTSNVNLELDKSSKRQSDNLKINFGELEMIDRIGAGAFGEIYKCRWRGTLVAAKIIKTAKIRKEWNERDLAIADFHQEISVLKSLRHPQIVLLLAYSTTADYEVMISELMKCSLLDVFKSHMVQGTRMRKRTQIIYATQLARGMNYLHTCSPPIIHRDLKPANLLIDHSGVLKISDFGLSKIRPDPGKKETEKYTMTGETGSYRFMAPEVFRHEEYNETVDIYSYAMILFYLLVGRPPWPTISGMNAVKKAAEEGDRPNVPRDMDLRMQSLLKECWDENASMRPAFQRILANLE

HMMSmart: SM00248
IPR002110
7-36 ANK
Ankyrin repeat

DKRTALHLASGEGHASIVLALCEAGADPNV

ProfileScan: PS50088
IPR002110
7-39 ANK_REPEAT
Ankyrin repeat

DKRTALHLASGEGHASIVLALCEAGADPNVEDR

HMMPfam: PF00023
IPR002110
7-38 Ank
Ankyrin repeat

DKRTALHLASGEGHASIVLALCEAGADPNVED

Gene3D: G3DSA:3.30.200.20
79-219 G3DSA:3.30.200.20

SNVNLELDKSSKRQSDNLKINFGELEMIDRIGAGAFGEIYKCRWRGTLVAAKIIKTAKIRKEWNERDLAIADFHQEISVLKSLRHPQIVLLLAYSTTADYEVMISELMKCSLLDVFKSHMVQGTRMRKRTQIIYATQLARG

superfamily: SSF56112
IPR011009
89-367 Kinase_like
Protein kinase-like domain

SKRQSDNLKINFGELEMIDRIGAGAFGEIYKCRWRGTLVAAKIIKTAKIRKEWNERDLAIADFHQEISVLKSLRHPQIVLLLAYSTTADYEVMISELMKCSLLDVFKSHMVQGTRMRKRTQIIYATQLARGMNYLHTCSPPIIHRDLKPANLLIDHSGVLKISDFGLSKIRPDPGKKETEKYTMTGETGSYRFMAPEVFRHEEYNETVDIYSYAMILFYLLVGRPPWPTISGMNAVKKAAEEGDRPNVPRDMDLRMQSLLKECWDENASMRPAFQRILA

ProfileScan: PS50011
IPR000719
103-370 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEMIDRIGAGAFGEIYKCRWRGTLVAAKIIKTAKIRKEWNERDLAIADFHQEISVLKSLRHPQIVLLLAYSTTADYEVMISELMKCSLLDVFKSHMVQGTRMRKRTQIIYATQLARGMNYLHTCSPPIIHRDLKPANLLIDHSGVLKISDFGLSKIRPDPGKKETEKYTMTGETGSYRFMAPEVFRHEEYNETVDIYSYAMILFYLLVGRPPWPTISGMNAVKKAAEEGDRPNVPRDMDLRMQSLLKECWDENASMRPAFQRILANLE

HMMPfam: PF00069
IPR017442
104-367 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EMIDRIGAGAFGEIYKCRWRGTLVAAKIIKTAKIRKEWNERDLAIADFHQEISVLKSLRHPQIVLLLAYSTTADYEVMISELMKCSLLDVFKSHMVQGTRMRKRTQIIYATQLARGMNYLHTCSPPIIHRDLKPANLLIDHSGVLKISDFGLSKIRPDPGKKETEKYTMTGETGSYRFMAPEVFRHEEYNETVDIYSYAMILFYLLVGRPPWPTISGMNAVKKAAEEGDRPNVPRDMDLRMQSLLKECWDENASMRPAFQRILA

PatternScan: PS00107
IPR017441
109-130 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGAGAFGEIYKCRWRGTLVAAK

Gene3D: G3DSA:1.10.510.10
220-368 G3DSA:1.10.510.10

MNYLHTCSPPIIHRDLKPANLLIDHSGVLKISDFGLSKIRPDPGKKETEKYTMTGETGSYRFMAPEVFRHEEYNETVDIYSYAMILFYLLVGRPPWPTISGMNAVKKAAEEGDRPNVPRDMDLRMQSLLKECWDENASMRPAFQRILAN

PatternScan: PS00108
IPR008271
230-242 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPANLLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox