PRGDB00080757 (Pvr.1129)

From PRG Wiki
Jump to: navigation, search
Pvr.1129
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 198384419 (GD052043)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Saccharum hybrid cultivar

Comment?

CCHZ30911.b1 CCHZ Panicum virgatum abiotic and biotic stress treatments (N) Panicum virgatum cDNA clone CCHZ30911 5', mRNA sequence

DNA Sequence

CGTTTGTTCTCTTTTGCTTCACTGCTCTAGCAATAGGAAGCTTGGCAGTTCTTTGTTGGAGGAAAAAATTTAAGAAATGCAGGACCAAAAGCAAGCCTGGAGATATGTTCTCCATATGGAATTTCAACGGGAAGATTGCATTCCAAGACATACTCGACGCAACAGAAAATTTTGATGAAAAATATTGCATTGGTTCTGGAGGACACGGGTCTGTCTTCAGAGCTGAGGTTCGAGGAAGTGTCTTTGCAGTCAAGCTGCTCCACTCGATGGAAGACTGCACAGATGAAGGAACATTTCATGCTGAGATCGATGTGCTGACCAAAACAAGGCATCGATGCATAGTCAAGCTGTATGGGTACTGTTCTCACTCTCAGTGCAGATTTCTGGTGTACGATCTCATGGAAAGGGGAAGCCTAGCATACATTCTTCACGAGGAGCAACTTGCAAGGGAGTTTGACTGGCCCAAAAGAGTTGCCATTGTGAGAGATGTAGCTCAAGCTCTCTCTTACCTGCACCACGATTGTGATGAACCCATCATACATCGTGACATCAAAAGTAACAATATCTTATTAGACCGTGATTTTAAAAGCTATGTCTCAGATTTTGGCATGGCAAGGAAGTTGAAGCATATTTACTCGAGTTCAAGTACTATCTTTGCAGGGACATGTGGCTACATGGCACCAGAATTATCTTCTACAATGGTGTTGACAGAGAAGTGTGATGTATATAGCTTTGGTGTGGTTGTCATGAAGTGGTGATGGGAAAGCACCCAGGAGATCTTCTGCTTCCCATTCTTTTGCCA


Protein sequences

Name Description Sequence
Pvr.1129 translated coding region predicted by ESTScan from UniGene Pvr.1129

XFVLFCFTALAIGSLAVLCWRKKFKKCRTKSKPGDMFSIWNFNGKIAFQDILDATENFDEKYCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYGYCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVMKWXWESTQEIFCFPFFCX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
10-250 FAMILY NOT NAMED,FAMILY NOT NAMED

LAIGSLAVLCWRKKFKKCRTKSKPGDMFSIWNFNGKIAFQDILDATENFDEKYCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYGYCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVM

HMMPanther: PTHR24420:SF472
10-250 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LAIGSLAVLCWRKKFKKCRTKSKPGDMFSIWNFNGKIAFQDILDATENFDEKYCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYGYCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVM

Seg: seg
22-32 seg

KKFKKCRTKSK

superfamily: SSF56112
IPR011009
30-250 Protein kinase-like (PK-like)
Protein kinase-like domain

KSKPGDMFSIWNFNGKIAFQDILDATENFDEKYCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYGYCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVM

Gene3D: G3DSA:3.30.200.20
46-119 no description

IAFQDILDATENFDEKYCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYG

HMMSmart: SM00219
IPR020635
56-266 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ENFDEKYCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYGYCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVMKWXWESTQEIFCFPFF

ProfileScan: PS50011
IPR000719
58-268 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEKYCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYGYCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVMKWXWESTQEIFCFPFFCX

HMMSmart: SM00220
IPR002290
58-266 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDEKYCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYGYCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVMKWXWESTQEIFCFPFF

HMMPfam: PF00069
IPR017442
62-251 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YCIGSGGHGSVFRAEVRGSVFAVKLLHSMEDCTDEGTFHAEIDVLTKTRHRCIVKLYGYCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVMK

PatternScan: PS00107
IPR017441
64-85 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGGHGSVFRAEVRGSVFAVK

Gene3D: G3DSA:1.10.510.10
120-250 no description

YCSHSQCRFLVYDLMERGSLAYILHEEQLAREFDWPKRVAIVRDVAQALSYLHHDCDEPIIHRDIKSNNILLDRDFKSYVSDFGMARKLKHIYSSSSTIFAGTCGYMAPELSSTMVLTEKCDVYSFGVVVM

PatternScan: PS00108
IPR008271
179-191 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSNNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox