PRGDB00081010 (Pvr.22759)

From PRG Wiki
Jump to: navigation, search
Pvr.22759
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 198379562 (GD044893)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Saccharum hybrid cultivar

Comment?

CCHZ23701.b1 CCHZ Panicum virgatum abiotic and biotic stress treatments (N) Panicum virgatum cDNA clone CCHZ23701 5', mRNA sequence

DNA Sequence

GAGGTGGCCATCCTATCCCAGATAATTCATCGCAATGTGGTGAAACTTTTTGGTTGTTGCCTTGAATCCGAGGTGCCTCTTCTCGTGTATGAATTCATCTCCAATGGCACACTTCATGATCTTCTTCATGGCGATCTGGGTGCCAAATGCTTGTTAACATGGGAGGATCGTATCAGGATTGCTCTAGAAGCTGCAGGGGCACTTGCTTACCTCCATTCTTCTGCCGCTATACCAATCTTTCATAGAGATGTGAAATCAACTAACATACTCTTGGATGATGCCCTCACCACAAAGGTTTCAGACTTTGGTGCTTCCAGATCCATTTCGATTGATCAGACTCGTGTGGTTACAGCTGTGCAGGGGACATTTGGGTACTTAGATCCAGAATATTACTATACGGGCCAGTTGACTGAAAAGAGTGATGTTTATAGTTTTGGCGTGATACTTGTTGAGCTCGTAACACGGAAAAAGTCAATTTTCCTCAACTGCGTTGGTGAAAAGCAGAACTTGTGTCATTGTTTCCTTCAAGCACTTAGGGATAAAACTATTATGGATATGGTGGACCCTCAAGTTGCTGAGGAAGCCAACCAAAGTGAAACTGATGAAATTGCCGTGGTTGCGGAGATGTGTTTAAGGTCTAAAGGAGAAAACAGACCTAAAATGAAGAGGTGGAGTTAAGATTGCAACCCCTAGAGCTAAAATATCTAGAACACACAAAGAGGAGTCAAAAGAGGCAGGGAAACCTCGCAATCATTATCTCAGAGTATAAGATCTACTCCCTGACATGAC


Protein sequences

Name Description Sequence
Pvr.22759 translated coding region predicted by ESTScan from UniGene Pvr.22759

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTLHDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMKRWS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
1-38 no description

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTL

superfamily: SSF56112
IPR011009
1-222 Protein kinase-like (PK-like)
Protein kinase-like domain

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTLHDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMK

HMMPfam: PF07714
IPR001245
1-223 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTLHDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMKR

ProfileScan: PS50011
IPR000719
1-225 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTLHDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMKRWS

HMMPanther: PTHR24420
1-222 FAMILY NOT NAMED,FAMILY NOT NAMED

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTLHDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMK

HMMSmart: SM00220
IPR002290
1-225 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTLHDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMKRWS

HMMSmart: SM00219
IPR020635
1-224 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTLHDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMKRW

HMMPanther: PTHR24420:SF444
1-222 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EVAILSQIIHRNVVKLFGCCLESEVPLLVYEFISNGTLHDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMK

Seg: seg
38-47 seg

LHDLLHGDLG

Gene3D: G3DSA:1.10.510.10
39-222 no description

HDLLHGDLGAKCLLTWEDRIRIALEAAGALAYLHSSAAIPIFHRDVKSTNILLDDALTTKVSDFGASRSISIDQTRVVTAVQGTFGYLDPEYYYTGQLTEKSDVYSFGVILVELVTRKKSIFLNCVGEKQNLCHCFLQALRDKTIMDMVDPQVAEEANQSETDEIAVVAEMCLRSKGENRPKMK

PatternScan: PS00108
IPR008271
79-91 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IFHRDVKSTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox