PRGDB00081028 (Pvr.25890)

From PRG Wiki
Jump to: navigation, search
Pvr.25890
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 198384691 (GD048285)
Gene Class Unknown
Domain Type
Gene Species Saccharum hybrid cultivar

Comment?

CCHZ28729.b1 CCHZ Panicum virgatum abiotic and biotic stress treatments (N) Panicum virgatum cDNA clone CCHZ28729 5', mRNA sequence

DNA Sequence

GACGGAGAAGCAATATCGATCTTATTGGAAGAACCCACCCTACAATGCCATGCGCTATCTTATGACACTTCTCTATGGTATTGTGTTCGGTACAGTCTTTTGGCGCATGGGAAAGAATGTAGAATCACAGCAGGACCTGGGCAGTCTACTTGGAGCCACCTATGCTTGTATTTTCTTCCTTGGAGCTGCAAATTTGCTCACAGCTCTTCCGGTTTTTTCTATCGAAAGGACAGTCTTCTATCGTGAAAAGGCTGCTGGGATGTTCTCTCCATTGTCCTATGCATTTGCTATGACAGCCGTGGAGTTTCTCTACTGCATAGCTCAGGGTATTCTTTATACTATCCCTATCTACACTATGATTGGCTATGACTGGAAGGCAGACAAGTTTTTCTACTTCCTGTTCTTTATCACCGCAAGCTTCCTCTACTTCTCGATGTTTGGTGCCATGCTGATTTCCTGCACTCCTTCCCAAATACTTGCAAGTATTCTTGTCTCAATCATTCTCACATGTTGGAACATTTTCTCTGGATTCCTCATAACCCGACCGGCATTGCCTGTCTGGTGGCGATGGTTCTACTGGTGTAACCCGGTGGCCTGGACCATCTACGGCGTTATTGTGTCGCAGTTTGGCGACATAAGCCGCACGGTTACAGTTCCTGGCAACCCCAATAAAATAGTGAGGGAAATTCTGAAAGAAACTTATGGCATGAAGCATGACTTCCTCGGCTACGTCGTGCTGGCGCACTTTGGCTACATCCTCATTTTCCTCTTCCTCTTCGCGTACGGCACCAAGACCTTGAACTTCC


Protein sequences

Name Description Sequence
Pvr.25890 translated coding region predicted by ESTScan from UniGene Pvr.25890

XTEKQYRSYWKNPPYNAMRYLMTLLYGIVFGTVFWRMGKNVESQQDLGSLLGATYACIFFLGAANLLTALPVFSIERTVFYREKAAGMFSPLSYAFAMTAVEFLYCIAQGILYTIPIYTMIGYDWKADKFFYFLFFITASFLYFSMFGAMLISCTPSQILASILVSIILTCWNIFSGFLITRPALPVWWRWFYWCNPVAWTIYGVIVSQFGDISRTVTVPGNPNKIVREILKETYGMKHDFLGYVVLAHFGYILIFLFLFAYGTKTLNFX


Domains

Domain Start-End Description Sequence

HMMPfam: PF01061
IPR013525
3-210 ABC2_membrane
ABC-2 type transporter

EKQYRSYWKNPPYNAMRYLMTLLYGIVFGTVFWRMGKNVESQQDLGSLLGATYACIFFLGAANLLTALPVFSIERTVFYREKAAGMFSPLSYAFAMTAVEFLYCIAQGILYTIPIYTMIGYDWKADKFFYFLFFITASFLYFSMFGAMLISCTPSQILASILVSIILTCWNIFSGFLITRPALPVWWRWFYWCNPVAWTIYGVIVSQF

HMMPanther: PTHR19241:SF10
4-269 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

KQYRSYWKNPPYNAMRYLMTLLYGIVFGTVFWRMGKNVESQQDLGSLLGATYACIFFLGAANLLTALPVFSIERTVFYREKAAGMFSPLSYAFAMTAVEFLYCIAQGILYTIPIYTMIGYDWKADKFFYFLFFITASFLYFSMFGAMLISCTPSQILASILVSIILTCWNIFSGFLITRPALPVWWRWFYWCNPVAWTIYGVIVSQFGDISRTVTVPGNPNKIVREILKETYGMKHDFLGYVVLAHFGYILIFLFLFAYGTKTLNF

HMMPanther: PTHR19241
4-269 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

KQYRSYWKNPPYNAMRYLMTLLYGIVFGTVFWRMGKNVESQQDLGSLLGATYACIFFLGAANLLTALPVFSIERTVFYREKAAGMFSPLSYAFAMTAVEFLYCIAQGILYTIPIYTMIGYDWKADKFFYFLFFITASFLYFSMFGAMLISCTPSQILASILVSIILTCWNIFSGFLITRPALPVWWRWFYWCNPVAWTIYGVIVSQFGDISRTVTVPGNPNKIVREILKETYGMKHDFLGYVVLAHFGYILIFLFLFAYGTKTLNF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox