PRGDB00081102 (Pvr.38927)

From PRG Wiki
Jump to: navigation, search
Pvr.38927
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 198380002 (GD044683)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Saccharum hybrid cultivar

Comment?

CCHZ23583.b1 CCHZ Panicum virgatum abiotic and biotic stress treatments (N) Panicum virgatum cDNA clone CCHZ23583 5', mRNA sequence

DNA Sequence

GAAGAAATAGCTGTGAAGAGGCTTTCGCAGGATTCCTCACAGGGGTTCCAAGAGCTTAAGAACGAGCTCGTGCTGGCTGCCAAGCTCAAGCACAGGAACCTGGTCCAGCTTCTGGGGGTGTCCTTGCAAGAAGAGAAGCTGGTCATCTACGAGTATATGCCCAATAGAAGCCTAGATACCTTCCTTTCCGATCCAATGAGACGGAAGCAGCTGGATTGGAGCAAGAGGTTTTCCATCATCTGTGGTATCGCGCGGGGACTTCTTTACCTCCATGAGGAGTCCCGCTTAAAGGTCATCCACAGAGATCTAAAGCCGAGCAATGTGTTGCTTGATGCGGATATGAACCCCAAAATTTCAGATTTCGGAATTGCCAGGGCTTTCACCGTAGACCAATCTAGAGATATAACAAGAAGACCTGTTGGAACCCTCGGGTACATGTCCCCAGAGTATGCCTACTGGGGTCATGTTTCGACCAAGTCGGACATATTCAGCTTTGGTGTCATAGTCCTAGAGATGGTGACCGGGCGAAGGAACAATAGCGCATACAACAACACTTCTGACTCCATATCTGTTCTGAGCCATGTTTGGGACAAGTGGAGGGCTGGTTCAATGGTGGATGTCGTAGACCCATTGCTAGCTGAGTCTGGGTACCCAGAAAGCGAGGTCCTAAACTGCATAGAGATCGGGCTTCTATGCGTCCAGGAAAACCCGGTGGATCGGCCAGACGCCTCGGCGGTGGTGCTTATGCTCAGCAGTCCGACCACACGTCCGATGACAGACGAGC


Protein sequences

Name Description Sequence
Pvr.38927 translated coding region predicted by ESTScan from UniGene Pvr.38927

EEIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMPNRSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAYNNTSDSISVLSHVWDKWRAGSMVDVVDPLLAESGYPESEVLNCIEIGLLCVQENPVDRPDASAVVLMLSSPTTRPMTDEX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-255 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EEIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMPNRSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAYNNTSDSISVLSHVWDKWRAGSMVDVVDPLLAESGYPESEVLNCIEIGLLCVQENPVDRPDASAVVLMLSSPTT

superfamily: SSF56112
IPR011009
1-250 Protein kinase-like (PK-like)
Protein kinase-like domain

EEIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMPNRSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAYNNTSDSISVLSHVWDKWRAGSMVDVVDPLLAESGYPESEVLNCIEIGLLCVQENPVDRPDASAVVLML

HMMPanther: PTHR24420
1-252 FAMILY NOT NAMED,FAMILY NOT NAMED

EEIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMPNRSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAYNNTSDSISVLSHVWDKWRAGSMVDVVDPLLAESGYPESEVLNCIEIGLLCVQENPVDRPDASAVVLMLSS

HMMPanther: PTHR24420:SF430
1-252 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EEIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMPNRSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAYNNTSDSISVLSHVWDKWRAGSMVDVVDPLLAESGYPESEVLNCIEIGLLCVQENPVDRPDASAVVLMLSS

HMMSmart: SM00219
IPR020635
1-250 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EEIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMPNRSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAYNNTSDSISVLSHVWDKWRAGSMVDVVDPLLAESGYPESEVLNCIEIGLLCVQENPVDRPDASAVVLML

HMMSmart: SM00220
IPR002290
1-255 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

EEIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMPNRSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAYNNTSDSISVLSHVWDKWRAGSMVDVVDPLLAESGYPESEVLNCIEIGLLCVQENPVDRPDASAVVLMLSSPTT

HMMPfam: PF00069
IPR017442
2-182 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMPNRSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAY

Gene3D: G3DSA:3.30.200.20
2-54 no description

EIAVKRLSQDSSQGFQELKNELVLAAKLKHRNLVQLLGVSLQEEKLVIYEYMP

Gene3D: G3DSA:1.10.510.10
56-250 no description

RSLDTFLSDPMRRKQLDWSKRFSIICGIARGLLYLHEESRLKVIHRDLKPSNVLLDADMNPKISDFGIARAFTVDQSRDITRRPVGTLGYMSPEYAYWGHVSTKSDIFSFGVIVLEMVTGRRNNSAYNNTSDSISVLSHVWDKWRAGSMVDVVDPLLAESGYPESEVLNCIEIGLLCVQENPVDRPDASAVVLML

PatternScan: PS00108
IPR008271
98-110 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKPSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox