PRGDB00081121 (Pvr.40339)

From PRG Wiki
Jump to: navigation, search
Pvr.40339
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 198379059 (GD046210)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Saccharum hybrid cultivar

Comment?

CCHZ24462.g1 CCHZ Panicum virgatum abiotic and biotic stress treatments (N) Panicum virgatum cDNA clone CCHZ24462 3', mRNA sequence

DNA Sequence

AGTCACAATGCTAATGTTTCAGATTACTATAGACAAGTTCACGCATACAATTTATTATTTTAGAGGACAACATCCACCCGATATTGAGTAATTACTTTGTAGACCGTATAAAGGCAATACTTACTTCAAGATCAGTAACCTTCTGCCAATAATTTTGTCTGTTCACCTTGGGACAGAGAGCCCTGATGCTATAGGCGGAGTTGACAAATGGGTCCCTCCAACTGGAACAGCGATCGAAGCGCTTAGATCAAAGAAGTTATACTGCAAGTTTGGTTCCACTTGCCTTTCTCCTTCCAGGACCTTCACCACCAACGACATAGCAGGCCTTCTATGGCTGTCACTCTGTAGACACCAAATTGCAAGATTCATCAACTCAATCACTTCTTCCTTGTGTATATGCACGTCTTCACTGTTCCTGTCGATCATATCATCCAATTCATTGTTCTTTGCCTTCTCCTGCAGCAAGTTGATGAGTTGAATGCTACCTTCAGGTTGGGAATAATCTAGATTTCTTCTGCCGCAGATGATCTCCATGACTACCACACCAAAGCTATAGACATCAACCTTCTCGGTAATTTGTGATGTTAACCAT


Protein sequences

Name Description Sequence
Pvr.40339 translated coding region predicted by ESTScan from UniGene Pvr.40339

XWLTSQITEKVDVYSFGVVVMEIICGRRNLDYSQPEGSIQLINLLQEKAKNNELDDMIDRNSEDVHIHKEEVIELMNLAIWCLQSDSHRRPAMSLVVKVLEGERQVEPNLQYNFFDLSASIAVPVGGTHLSTPPIASGLSVPR

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-108 Protein kinase-like (PK-like)
Protein kinase-like domain

WLTSQITEKVDVYSFGVVVMEIICGRRNLDYSQPEGSIQLINLLQEKAKNNELDDMIDRNSEDVHIHKEEVIELMNLAIWCLQSDSHRRPAMSLVVKVLEGERQVEP

HMMPanther: PTHR24420:SF442
4-135 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TSQITEKVDVYSFGVVVMEIICGRRNLDYSQPEGSIQLINLLQEKAKNNELDDMIDRNSEDVHIHKEEVIELMNLAIWCLQSDSHRRPAMSLVVKVLEGERQVEPNLQYNFFDLSASIAVPVGGTHLSTPPI

HMMPanther: PTHR24420
4-135 FAMILY NOT NAMED,FAMILY NOT NAMED

TSQITEKVDVYSFGVVVMEIICGRRNLDYSQPEGSIQLINLLQEKAKNNELDDMIDRNSEDVHIHKEEVIELMNLAIWCLQSDSHRRPAMSLVVKVLEGERQVEPNLQYNFFDLSASIAVPVGGTHLSTPPI

Gene3D: G3DSA:1.10.510.10
5-99 no description

SQITEKVDVYSFGVVVMEIICGRRNLDYSQPEGSIQLINLLQEKAKNNELDDMIDRNSEDVHIHKEEVIELMNLAIWCLQSDSHRRPAMSLVVKV

HMMPfam: PF00069
IPR017442
5-95 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SQITEKVDVYSFGVVVMEIICGRRNLDYSQPEGSIQLINLLQEKAKNNELDDMIDRNSEDVHIHKEEVIELMNLAIWCLQSDSHRRPAMSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox