PRGDB00081126 (Pvr.41082)

From PRG Wiki
Jump to: navigation, search
Pvr.41082
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 198379732 (GD045687)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Saccharum hybrid cultivar

Comment?

CCHZ24159.g1 CCHZ Panicum virgatum abiotic and biotic stress treatments (N) Panicum virgatum cDNA clone CCHZ24159 3', mRNA sequence

DNA Sequence

CAATTGCAAGCTTGTCCTTTTATTCCTTTAGCTCAACAATAGCACAACTTTCAAATTTGCTAAAACAAAAATATATACCTACTGCAAGATGAATTATTACAATAAAGCTGCATCAGAGCGTTTTGTTATAGCTGCAAGGAGTCTTGGCATTGGGGGCATATCAATCTCCTGGAGACCCTCAAGAACACGAACTACTTCACCCATTGTTGGCCGATCACATTCATTATCTTGGATACACCAAAATGCAACTTTGCAAACCCTTTCAACCTCTTCTAAGTCGAAGTCACCATGTAATTGTGGATCCACCAAACTCTGTAGATCCCCCGCATGAAGCTTGCTGATGCCCTGCACCGGCAAAAACACAACATGATAACTGCTCTTACTGTTTACTTCTGGTGTGTTCCTCTTTCCTGATATGATTTCCAACAATACCATACCAAAACTGTAAACATCAACTTTTGGTGTAATAGCAACTCCGCTAAGCCACTCCGGGGCAAGATACCCTGCCGTTCCTCGGAATGTAGTCATCACTCGGCTAAAATCCCTTCCTACAACCGCCGCCATCCCAAAGTCTGCAATTTTAGGAGCAAACGATTCGTCGAGAAGTATGTTTTCTGGCTTAATATCACAGTGTATGATGCATTCGCGACAACTCTGATGCAAGTAGCATAACGCCTGGCAACTCCTACGGCTATTGATACCTTGTGCTCCAGTTCAGGATGACTGCATGCTCTGAAATAGATGGGCATCAGAGACCCAT


Protein sequences

Name Description Sequence
Pvr.41082 translated coding region predicted by ESTScan from UniGene Pvr.41082

XGSLMPIYFRACSHPELEHKVSIAVGVARRYATCIRVVANASYTXDIKPENILLDESFAPKIADFGMAAVVGRDFSRVMTTFRGTAGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGKRNTPEVNSKSSYHVVFLPVQGISKLHAGDLQSLVDPQLHGDFDLEEVERVCKVAFWCIQDNECDRPTMGEVVRVLEGLQEIDMPPMPRLLAAITKRSDAALL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-197 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGSLMPIYFRACSHPELEHKVSIAVGVARRYATCIRVVANASYTXDIKPENILLDESFAPKIADFGMAAVVGRDFSRVMTTFRGTAGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGKRNTPEVNSKSSYHVVFLPVQGISKLHAGDLQSLVDPQLHGDFDLEEVERVCKVAFWCIQDNECDRPTMGEVVRVLEGL

HMMSmart: SM00220
IPR002290
2-194 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GSLMPIYFRACSHPELEHKVSIAVGVARRYATCIRVVANASYTXDIKPENILLDESFAPKIADFGMAAVVGRDFSRVMTTFRGTAGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGKRNTPEVNSKSSYHVVFLPVQGISKLHAGDLQSLVDPQLHGDFDLEEVERVCKVAFWCIQDNECDRPTMGEVVRVL

superfamily: SSF56112
IPR011009
46-221 Protein kinase-like (PK-like)
Protein kinase-like domain

DIKPENILLDESFAPKIADFGMAAVVGRDFSRVMTTFRGTAGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGKRNTPEVNSKSSYHVVFLPVQGISKLHAGDLQSLVDPQLHGDFDLEEVERVCKVAFWCIQDNECDRPTMGEVVRVLEGLQEIDMPPMPRLLAAITKRSDAALL

Gene3D: G3DSA:1.10.510.10
46-202 no description

DIKPENILLDESFAPKIADFGMAAVVGRDFSRVMTTFRGTAGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGKRNTPEVNSKSSYHVVFLPVQGISKLHAGDLQSLVDPQLHGDFDLEEVERVCKVAFWCIQDNECDRPTMGEVVRVLEGLQEIDM

HMMPfam: PF00069
IPR017442
46-191 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DIKPENILLDESFAPKIADFGMAAVVGRDFSRVMTTFRGTAGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGKRNTPEVNSKSSYHVVFLPVQGISKLHAGDLQSLVDPQLHGDFDLEEVERVCKVAFWCIQDNECDRPTMGEVV

HMMPanther: PTHR24420
46-209 FAMILY NOT NAMED,FAMILY NOT NAMED

DIKPENILLDESFAPKIADFGMAAVVGRDFSRVMTTFRGTAGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGKRNTPEVNSKSSYHVVFLPVQGISKLHAGDLQSLVDPQLHGDFDLEEVERVCKVAFWCIQDNECDRPTMGEVVRVLEGLQEIDMPPMPRLL

HMMPanther: PTHR24420:SF442
46-209 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DIKPENILLDESFAPKIADFGMAAVVGRDFSRVMTTFRGTAGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGKRNTPEVNSKSSYHVVFLPVQGISKLHAGDLQSLVDPQLHGDFDLEEVERVCKVAFWCIQDNECDRPTMGEVVRVLEGLQEIDMPPMPRLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox