PRGDB00142537 (AcoGoldSmith_v1.021516m)

From PRG Wiki
Jump to: navigation, search
AcoGoldSmith_v1.021516m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium arboreum

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGACAGGGAAGGATGCGACCAAAGATTTCAAGGAATTTCATAGTCACAGTAGCGATGCAATGACAATGATGGATAAATTCTATGTTGGGGTGTATGATTTAATTAATAGTTTATTAATTAAACTAGCAAGTGATAAGCCACAGCCATATTCACATGAGGAACTTGTGGATTTCACGAAAAATTTCTCTTTTCCATTAGGTTCTGGAGGGTTTGGAGATGTCTACAAAGGTAAACTTCCTAATGGTGTGTTGATAGCCGTTAAGGTTTTGAAAGGCATCGACAAAGAGAAGATTATGGAAGAGCAATTTGCAGCTGAAGTTGAAACTATGGGCAGAACTTACCATCGAAACTTAATTAAACTATATGGTTATTGCTATGAAGCCGACACGAAAGCACTTATCTATGAATACATGGAGAATGGAGCTTTAGATGTGATTCTGAAGAAGAACAATCTTGATATGGTGAAGTTGCATAATATTGCAATAGAGATAGCACAGGGGATCTCTTATTTGCATGAGAGTTGTCGTCCACAAATCATCCACCAGGACATAAAGCCTGCTAATGTGCTGCTTGACTCAAACCTTTCTCCTAAGGTTATAGATTTTGGATTGGCAAAGGTTAATATGGGAGAAAGTCAATTCGAACAAAGCAAAATCAAAGGAACGCGTAATTATATGGCTCCAGAGGTAAATCAGCCTAACCAAGTAAGACTAAGTTGCAAATGCGATGTTTACAGCTTCGGCATGATGTTGTTTGATATTTTGGGGAGCAAGAGGAATCATGTAGACAAAAGGTTCTGGTTTCCAGGCCAAGTTTGGGATAAGTTTAATACAAACCAGCTTGATAAATTTATTCTTGACTGTGGTATTAAAGAGGAGGATAAGGATAGTGCAAAGAGGTTATCGGTAGTAGCTTTACTGTGTGTTGAGCACAACCCTGTAGCTAGGCCAATGATGAGCACTGTGGTGAAGATGCTTGAGGGTAAAATAAAACAACTTGATGCTCCAACCACTCCATTTTATCCTAATTATTACTTGTCAAGTGAAAGCAGCTCG


Protein sequences

Name Description Sequence
AcoGoldSmith_v1.021516m Protein kinase superfamily protein (best arabidopsis hit)

MTGKDATKDFKEFHSHSSDAMTMMDKFYVGVYDLINSLLIKLASDKPQPYSHEELVDFTKNFSFPLGSGGFGDVYKGKLPNGVLIAVKVLKGIDKEKIMEEQFAAEVETMGRTYHRNLIKLYGYCYEADTKALIYEYMENGALDVILKKNNLDMVKLHNIAIEIAQGISYLHESCRPQIIHQDIKPANVLLDSNLSPKVIDFGLAKVNMGESQFEQSKIKGTRNYMAPEVNQPNQVRLSCKCDVYSFGMMLFDILGSKRNHVDKRFWFPGQVWDKFNTNQLDKFILDCGIKEEDKDSAKRLSVVALLCVEHNPVARPMMSTVVKMLEGKIKQLDAPTTPFYPNYYLSSESSS

Domains

Domain Start-End Description Sequence

superfamily: SSF55856
IPR001199
1-33 Cytochrome b5-like heme/steroid binding domain
Cytochrome b5

MTGKDATKDFKEFHSHSSDAMTMMDKFYVGVYD

Gene3D: G3DSA:3.10.120.10
IPR001199
2-33 no description
Cytochrome b5

TGKDATKDFKEFHSHSSDAMTMMDKFYVGVYD

superfamily: SSF56112
IPR011009
32-334 Protein kinase-like (PK-like)
Protein kinase-like domain

YDLINSLLIKLASDKPQPYSHEELVDFTKNFSFPLGSGGFGDVYKGKLPNGVLIAVKVLKGIDKEKIMEEQFAAEVETMGRTYHRNLIKLYGYCYEADTKALIYEYMENGALDVILKKNNLDMVKLHNIAIEIAQGISYLHESCRPQIIHQDIKPANVLLDSNLSPKVIDFGLAKVNMGESQFEQSKIKGTRNYMAPEVNQPNQVRLSCKCDVYSFGMMLFDILGSKRNHVDKRFWFPGQVWDKFNTNQLDKFILDCGIKEEDKDSAKRLSVVALLCVEHNPVARPMMSTVVKMLEGKIKQLD

HMMPanther: PTHR24420
38-352 FAMILY NOT NAMED,FAMILY NOT NAMED

LLIKLASDKPQPYSHEELVDFTKNFSFPLGSGGFGDVYKGKLPNGVLIAVKVLKGIDKEKIMEEQFAAEVETMGRTYHRNLIKLYGYCYEADTKALIYEYMENGALDVILKKNNLDMVKLHNIAIEIAQGISYLHESCRPQIIHQDIKPANVLLDSNLSPKVIDFGLAKVNMGESQFEQSKIKGTRNYMAPEVNQPNQVRLSCKCDVYSFGMMLFDILGSKRNHVDKRFWFPGQVWDKFNTNQLDKFILDCGIKEEDKDSAKRLSVVALLCVEHNPVARPMMSTVVKMLEGKIKQLDAPTTPFYPNYYLSSESSS

Gene3D: G3DSA:3.30.200.20
43-137 no description

ASDKPQPYSHEELVDFTKNFSFPLGSGGFGDVYKGKLPNGVLIAVKVLKGIDKEKIMEEQFAAEVETMGRTYHRNLIKLYGYCYEADTKALIYEY

ProfileScan: PS50011
IPR000719
60-341 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KNFSFPLGSGGFGDVYKGKLPNGVLIAVKVLKGIDKEKIMEEQFAAEVETMGRTYHRNLIKLYGYCYEADTKALIYEYMENGALDVILKKNNLDMVKLHNIAIEIAQGISYLHESCRPQIIHQDIKPANVLLDSNLSPKVIDFGLAKVNMGESQFEQSKIKGTRNYMAPEVNQPNQVRLSCKCDVYSFGMMLFDILGSKRNHVDKRFWFPGQVWDKFNTNQLDKFILDCGIKEEDKDSAKRLSVVALLCVEHNPVARPMMSTVVKMLEGKIKQLDAPTTPFY

HMMSmart: SM00219
IPR020635
60-326 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

KNFSFPLGSGGFGDVYKGKLPNGVLIAVKVLKGIDKEKIMEEQFAAEVETMGRTYHRNLIKLYGYCYEADTKALIYEYMENGALDVILKKNNLDMVKLHNIAIEIAQGISYLHESCRPQIIHQDIKPANVLLDSNLSPKVIDFGLAKVNMGESQFEQSKIKGTRNYMAPEVNQPNQVRLSCKCDVYSFGMMLFDILGSKRNHVDKRFWFPGQVWDKFNTNQLDKFILDCGIKEEDKDSAKRLSVVALLCVEHNPVARPMMSTVVKML

HMMSmart: SM00220
IPR002290
60-315 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KNFSFPLGSGGFGDVYKGKLPNGVLIAVKVLKGIDKEKIMEEQFAAEVETMGRTYHRNLIKLYGYCYEADTKALIYEYMENGALDVILKKNNLDMVKLHNIAIEIAQGISYLHESCRPQIIHQDIKPANVLLDSNLSPKVIDFGLAKVNMGESQFEQSKIKGTRNYMAPEVNQPNQVRLSCKCDVYSFGMMLFDILGSKRNHVDKRFWFPGQVWDKFNTNQLDKFILDCGIKEEDKDSAKRLSVVALLCVEHNPVA

HMMPfam: PF00069
IPR017442
65-323 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

PLGSGGFGDVYKGKLPNGVLIAVKVLKGIDKEKIMEEQFAAEVETMGRTYHRNLIKLYGYCYEADTKALIYEYMENGALDVILKKNNLDMVKLHNIAIEIAQGISYLHESCRPQIIHQDIKPANVLLDSNLSPKVIDFGLAKVNMGESQFEQSKIKGTRNYMAPEVNQPNQVRLSCKCDVYSFGMMLFDILGSKRNHVDKRFWFPGQVWDKFNTNQLDKFILDCGIKEEDKDSAKRLSVVALLCVEHNPVARPMMSTVV

PatternScan: PS00107
IPR017441
66-88 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGGFGDVYKGKLPNGVLIAVK

Gene3D: G3DSA:1.10.510.10
138-338 no description

MENGALDVILKKNNLDMVKLHNIAIEIAQGISYLHESCRPQIIHQDIKPANVLLDSNLSPKVIDFGLAKVNMGESQFEQSKIKGTRNYMAPEVNQPNQVRLSCKCDVYSFGMMLFDILGSKRNHVDKRFWFPGQVWDKFNTNQLDKFILDCGIKEEDKDSAKRLSVVALLCVEHNPVARPMMSTVVKMLEGKIKQLDAPTT

PatternScan: PS00108
IPR008271
179-191 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHQDIKPANVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox