PRGDB00143462 (493465)

From PRG Wiki
Jump to: navigation, search
493465
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Arabidopsis lyrata

Comment?

Regulator of chromosome condensation (RCC1) family protein (best arabidopsis hit)

DNA Sequence

GAGACTGAAAAGAACTATGCTTCTTCGAGCTGGTGTTTGGATGAGTTGTTGGAGATTATCAAGTGCAAGGAAGCTATGGGACAAATAGTGATGACTGTTTTTTACGGAGTAGATCCATCTGATGTGCGGAAACAGACAGGAGAATTCGGGAGGGCTTTCGATGAAACGTGTTCTCGAAGTACGAAAGAGAAGAGGCGTAGATGGAGTCAAGCTTTGAACCATGTGGGAAACATAGCTGGAGAACACTTCCAAAACTGGGACAATGAGTCAAAGATGATTGAAAAGATTTCTAGAGATATTTCAAACATATTAAATACTACAATCTCTAGAGATTTTGATGATATGGTTGGGCTTGAAGCACACTTGGAGGAAATGAAGTATTTGTTAGATTTAGATTATGAGGATGGAGCTATGATAGTTGGAATATGTGGTCATGCAGGCATTGGTAAGACTACCATTGCTAGAGCTTTACATAGTTTACTCTCCAGTAGTTTCCAGCTTAGTTGTTTTATGGAGAATCTTAGGGGAAGCTTTAATAGTGGTCTTGACGAGTATGGCTCGAAGCTAAGTTTACAAGAGCAGCTTCTTTCAAAGATTTTAAACCAAAATGGTATGAGAATATACCATTTAGGTGCGATACAAGAAAGGCTATGTGACCAAAAAGTGCTAATCATTCTTGATGATACTAATTGGTTTGGTCCTGGAAGTAGGATCATTGTGACCACAGAAGATCAAGAGATTTTGGAGGAACATGGTATCAACAAAACTTACCATGTGGGTGGGGGCGGGGGGGATGAGTGGGAAGCTCTATTGGACAGGCTAGAAACTAGTCTTGATCGAAATGTCGAGGGAGCACTTAGAGTTGGGTATGATAGCTTACATGTAGAAGAACAAGCGCTATTTCGCTACATGGCGGTCTTTTTCAACTACAATAAAGATGATCATGTGATCGCAATGCTCGCTGACAGTAACTTGGATGTCAAACAAGGGTTGAAAATCCTAACCAAGAAATCACTCATATATAAATCTACCAGTGGGAAAATAGTAATGCACAAATTACTACAACAAGTGGGTAGACAAGCAATTCATAGACAAGAGCCTAGGAAACGCCACATCTTGATAGATGTAGATGAGATTTCTCTTGAGAATGACACAGATACTAGAGCTGCTATAGGCATATCGCTTGATACATCTGGAATCAACAAAGTTTTCATAAGTGAGGGAGCTTTCAAAAGAATGCGTAATCTTCGATTCCTAAGTGTCTACAAGACAAGATATGTTCAAAATGATCAAGTGGACATACCTAAGGACTTGGAGTTTCCACCTCATCTACGGTTACTTCGCTGGGAAGCATACCCACGAAATGCTCTTCCTACTACATTTCATCCAGAATATCTTATAGAACTCGATTTGCAAGAGAGCCAGCTTGAGAGGCTTTGGCAAGGAACACAGCCACTTACAAATCTCAAGAAAATGGATTTGACACGATCTTCTCATTTGAAGGAACTTCCAGATCTTTCAAATGCTACAAATCTCGAGAGATTGGAACTAAGTTATTGCAAGAGTTTGGTGGAGATTCCTTCCTCTTTTTCGGAACTTCGAAAACTAGAGACGTTGATAATACACAACTGCACAAAGCTAGAAGTTGTTCCAACTCTCATCAACTTGGCATCTCTTGATTTCGTCGACATGCAAGGTTGCTCACAATTAAAAAGTCTTCCAGGTATTTCTACACACATCTCAATACTCGTTATAGATGACACAGTGTTAGAAGAACTGCCTACATCAATCATACTTTGCACTCGTCTTACGTCTCTCTTTATAAAAGGCAGTGGAAACTTTAAGACATTAACACCTCTCCCTATGAGTCTAAAGTATCTAGACCTAAGGTGTACGGCTTCCTTTTTCGCTCAAGTGCTTAAATTCATATGTGGACTACAATTTCACCAATTGCTTCAAACTGAACCAAGAAGCACGAAGAGTATTATCCAACAATCATTCTTTCCCATGTTGAGAGTTTTACCAGGAAGAGAAGTGCCCGAAACGTTCAATCACCAAGCTAAAGGAAATTTCTTGACCATCAGTGATAGTCATTTTTCTGCATTCTCAAGATTTAAAGCTTGCATTGTGATTTCCCCTACCAGGTTAATCACTGAGAGAAGAAGGCTTATTAGTTTATTGTGTCGTCTCATAAGCAAAAACGGTGACTCCATCAACGAAGTTTATCATTGTTTTAGCTTACCTGATCAGTCCCCGGGAACACAATCGGAACATCTTTGTTTATTTCACGCTAACTTGCTCGAGAGAGATAGATCTGCACACCTTCTGACGCCTACGAGATTGTTCGATGTGGTGTTGAAATATATGGAGATCGAAATCGTCCAACAACAGAGCGATTGGACCATCAATGCATCTGAAGACGAAACTGTAAATATTTCTGACGACGTCCAGATAGACATACATGCAAATCCGATAAGGTATCTGAAGAAGCCAATGAATCCCTTATTTTTGGGTGGAGGAGCCGTGGTTGTGTCCCCTAGTGAACGTGTGATAGAGAAGGAATTGAAGACGGATGCATCTATGAAGACAGATGGAATGGCAGATCACTCTAGCTATGTCAATCACGACCGTGACATCGACCAAGCACTCGTTTCTCTGAAAAAAGGAACTCAATTACTTAAGTATAGCCGCAAAGGAAGGCCTAAATTTCGCTCATTCAGGCTTTCGCCGGCTGTTTTTCGAAGATATTTACGTCCTGAAAAGGATTACTTGTCATTTTCTCTCATATATCATAACGGAGATAGATCTCTTGATCTGATTTGCAAGGACAAAGCTGAAACAGAGATTTGGTTTGCAGGACTTAAGTCTTTAATTAGACAAAACCGTAACAAGCACGCCAAAAGTGAGATCCCTGAGATACATGACAGTGACTGTTTCTCCACTGGTCGTCCTTCTACTGCATCTATAGATTTCGCACCAAACAATACTCGACGAGGAAGAACATCCATTGATTTAGGAATCCAAAACTCTCCAACAAAGTTTGGTAGCTCAGATGTGGGATATGAACGTGGAAACATGCTAAGACCAAGTACTGATGGTTTTCGAATTAGTGTCTCAAGCACACCAAGTTGTTCAACTGGAACTTCTGGTCCCGATGACATAGAATCCTTAGGCGATGTTTATGTCTGGGGAGAAGTTTGTAGCGACGGGATATCACAAGATGGGACCGTTAACTGCAGAACCGTAAAAATAGATATAGCTTGCGGGGTAAGGCACATCGCTCTTGTAACAAGACAAGGTGAAGTCTTTACATGGGGAGAGGAAGCTGGAGGAAGGCTTGGACATGGTATTCAAGTCGACGTAAGTCGTCCAAAACTTGTTGAGTTTCTTGCTCTTACCAACATAGATTTTGTTGCATGTGGAGAATATCATACGTGTGCTGTTTCTACATCCGGAGATTTGTTTACTTGGGGAGACGGAATCCATAATGTTGGACTTTTGGGACATGGAAGTGATCTTAGTCATTGGATACCAAAAAGAGTCTCTGGTCCTGTTGAAGGACTTCAGGTTTTGTCTGTTGCGTGTGGCACGTGGCATTCGGCGCTTGCAACTGCTAATGGAAAACTATTCACTTTTGGTGATGGAGCGTTTGGTGTTCTTGGACATGGAGATAGAGAGAGTGTTTCATACCCTAAAGAAGTAAAAATGTTGAGTGGTCTTAAAACCATGAAAGTAGCTTGTGGCGTGTGGCATACGGTAGCTATAGTTGAAGTTATGAATCAGACCGGTACTAGTATGTCATCTAAAAAGTTGTTTACTTGGGGTGATGGTGATAAAAACAGGCTAGGACATGGAAATAAAGAGACTTATTTACTTCCCACTTGTGTCTCTTCACTAATTGACTACAACTTTCAACAAATAGCTTGTGGTCATACATTGACAGTTGCACTCACAACCTCAGGACATGTTTTCACTATGGGAGGGACTTCACATGGTCAGCTCGGTAGCTCAAATTCGGATGGTAAATTGCCTTGCTTGGTTCAAGATCGATTGGTTGGTGAATTCGTTGAAGAAATATCTTGTGGGGATCATCATGTTGCTGTCCTGACATCTAGAAGTGAAGTCTTCACTTGGGGAAAAGGTTCAAATGGAAGACTAGGACATGGGGACAAAGAAGATCGAAAAACGCCAACATTAGTTGAAGCTCTAAAGGAGAGGCATGTGAAGAGTATATCATGTGCTGATCAATCAGTTTGCTCTGGTTGTCGTCAAGCATTTGGTTTTACAAGAAAGAGGCATAATTGCTATAACTGCGGTTTAGTGCATTGTCATGCTTGTAGTTCCAAGAAAGCTTTGAAAGCAGCATTAGCTCCAACACCAGGGAAGCCACATCGAGTATGTGATGCTTGTTACACAAAACTTAAAGCTGGAGAGTCTGGTTATAACTCTAATGTTGCTAACAGAAATTCCACAACGCGGTCACTAGATGGGTCGGTCAGACCAGACAGAGATATAAGGTCGTCAAAGATTTTACTGTCCCCCAAAACAGAACCAGTCAAGTATTCTGAGGTTAGATCATCAAGATCTGAATCTTCTATTGTCAGAGCTTCACAAGTTCCAGCTCTCCAGCAACTTAGAGATGTCGCATTCCCAAGCTCGCTTAGCGCGATTCAAAATGCCTTGAAACCCGCTGCCTCAACTTCGACATCGACACTTTCCTCAGGTATAAGATCATCAAGAAGATCAAGCCCTCCACGTAGTTCTGGATTTTCCAGGAGCATGATTGACACTTTGAAGAAATCAAACGGTGTTATAAACAAAGAAATGACAAGATTGCAAAGCCAGATTAAAAATTTGAAAGAGAAATGTGATAATCAAGGTACAGAGATCCAAAGATTAAAGAAAACAGCAAGAGAAGCTTCTGACTTAGCTGTAAAACATTCTTCGAAGCATAAGGCAGCAACAGAGGTCATGAAATCTGTCGCTGAACATTTGAGAGAGTTAAAAGAGAAACTACCTCCTGAAGTATCTGGATGTGAAGCTTTTGAATCCATGAACTCTCAAGCAGAAGCTTATCTAAACGCGAGTGAAGCATCTGAATCATCTTTACCTACAACATCTGTGGGAATGGGTCAACAAGACCCAACCCCTTCTGCAAACACACAAGATCAAAACATAGAAGAAAAACCATCATCCAATGGAGGTAACATGAGGTCTCAAGAACCTTCAGGGACAACAGAAGCTTCATCATCATCTAAAGGAGGAGGCAAAGAACTTATCGAACAATTTGAACCCGGTGTTTATGTTACTTATGTATTGCACAAAAATGGTGGAAAGATCTTTAGAAGAGTTAGATTCAGCAAACGGAGATTTGATGAGCATCAAGCAGAAGAATGGTGGAATAGCAAAAAAGATAGGTTGCTTAAGAGGTATAGTCATCATGCTTCATCATCAAGTCCAACGGCTTCTGATCCTGTTCCTACACCAACTCAACCTCAACGACCAGCTTCTCCTACACAACCAACTCAACCTCAACCACCAGCTTCTCCTACACAACCAAATCCTGATCAAGCAGAGGATTCAGAGAAGTTCTTGAAAGCTA


Protein sequences

Name Description Sequence
493465 Regulator of chromosome condensation (RCC1) family protein (best arabidopsis hit)

ETEKNYASSSWCLDELLEIIKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRAFDETCSRSTKEKRRRWSQALNHVGNIAGEHFQNWDNESKMIEKISRDISNILNTTISRDFDDMVGLEAHLEEMKYLLDLDYEDGAMIVGICGHAGIGKTTIARALHSLLSSSFQLSCFMENLRGSFNSGLDEYGSKLSLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIILDDTNWFGPGSRIIVTTEDQEILEEHGINKTYHVGGGGGDEWEALLDRLETSLDRNVEGALRVGYDSLHVEEQALFRYMAVFFNYNKDDHVIAMLADSNLDVKQGLKILTKKSLIYKSTSGKIVMHKLLQQVGRQAIHRQEPRKRHILIDVDEISLENDTDTRAAIGISLDTSGINKVFISEGAFKRMRNLRFLSVYKTRYVQNDQVDIPKDLEFPPHLRLLRWEAYPRNALPTTFHPEYLIELDLQESQLERLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLIIHNCTKLEVVPTLINLASLDFVDMQGCSQLKSLPGISTHISILVIDDTVLEELPTSIILCTRLTSLFIKGSGNFKTLTPLPMSLKYLDLRCTASFFAQVLKFICGLQFHQLLQTEPRSTKSIIQQSFFPMLRVLPGREVPETFNHQAKGNFLTISDSHFSAFSRFKACIVISPTRLITERRRLISLLCRLISKNGDSINEVYHCFSLPDQSPGTQSEHLCLFHANLLERDRSAHLLTPTRLFDVVLKYMEIEIVQQQSDWTINASEDETVNISDDVQIDIHANPIRYLKKPMNPLFLGGGAVVVSPSERVIEKELKTDASMKTDGMADHSSYVNHDRDIDQALVSLKKGTQLLKYSRKGRPKFRSFRLSPAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEIWFAGLKSLIRQNRNKHAKSEIPEIHDSDCFSTGRPSTASIDFAPNNTRRGRTSIDLGIQNSPTKFGSSDVGYERGNMLRPSTDGFRISVSSTPSCSTGTSGPDDIESLGDVYVWGEVCSDGISQDGTVNCRTVKIDIACGVRHIALVTRQGEVFTWGEEAGGRLGHGIQVDVSRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTMKVACGVWHTVAIVEVMNQTGTSMSSKKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFQQIACGHTLTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKEDRKTPTLVEALKERHVKSISCADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKAGESGYNSNVANRNSTTRSLDGSVRPDRDIRSSKILLSPKTEPVKYSEVRSSRSESSIVRASQVPALQQLRDVAFPSSLSAIQNALKPAASTSTSTLSSGIRSSRRSSPPRSSGFSRSMIDTLKKSNGVINKEMTRLQSQIKNLKEKCDNQGTEIQRLKKTAREASDLAVKHSSKHKAATEVMKSVAEHLRELKEKLPPEVSGCEAFESMNSQAEAYLNASEASESSLPTTSVGMGQQDPTPSANTQDQNIEEKPSSNGGNMRSQEPSGTTEASSSSKGGGKELIEQFEPGVYVTYVLHKNGGKIFRRVRFSKRRFDEHQAEEWWNSKKDRLLKRYSHHASSSSPTASDPVPTPTQPQRPASPTQPTQPQPPASPTQPNPDQAEDSEKFLKA

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-78 TIR
Toll-Interleukin receptor

ETEKNYASSSWCLDELLEIIKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRAFDETCSRSTKEKRRRWSQALNHVGNI

HMMPfam: PF01582
IPR000157
4-74 TIR
Toll-Interleukin receptor

KNYASSSWCLDELLEIIKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRAFDETCSRSTKEKRRRWSQALNH

Gene3D: G3DSA:3.40.50.10140
4-76 G3DSA:3.40.50.10140

KNYASSSWCLDELLEIIKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRAFDETCSRSTKEKRRRWSQALNHVG

superfamily: SSF52540
5-302 SSF52540

NYASSSWCLDELLEIIKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRAFDETCSRSTKEKRRRWSQALNHVGNIAGEHFQNWDNESKMIEKISRDISNILNTTISRDFDDMVGLEAHLEEMKYLLDLDYEDGAMIVGICGHAGIGKTTIARALHSLLSSSFQLSCFMENLRGSFNSGLDEYGSKLSLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIILDDTNWFGPGSRIIVTTEDQEILEEHGINKTYHVGGGGGDEWEALLDRLETSLDRNVEGALRVGYDSLHVEEQALFR

Gene3D: G3DSA:3.40.50.300
86-152 G3DSA:3.40.50.300

WDNESKMIEKISRDISNILNTTISRDFDDMVGLEAHLEEMKYLLDLDYEDGAMIVGICGHAGIGKTT

HMMPfam: PF00931
IPR002182
120-257 NB-ARC,NBS
NB-ARC

AHLEEMKYLLDLDYEDGAMIVGICGHAGIGKTTIARALHSLLSSSFQLSCFMENLRGSFNSGLDEYGSKLSLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIILDDTNWFGPGSRIIVTTEDQEILEEHGINKTY

HMMSmart: SM00382
IPR003593
136-331 AAA,NBS
ATPase, AAA+ type, core

GAMIVGICGHAGIGKTTIARALHSLLSSSFQLSCFMENLRGSFNSGLDEYGSKLSLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIILDDTNWFGPGSRIIVTTEDQEILEEHGINKTYHVGGGGGDEWEALLDRLETSLDRNVEGALRVGYDSLHVEEQALFRYMAVFFNYNKDDHVIAMLADSNLDVKQGL

Gene3D: G3DSA:3.40.50.300
153-170 G3DSA:3.40.50.300

IARALHSLLSSSFQLSCF

Gene3D: G3DSA:3.40.50.300
212-232 G3DSA:3.40.50.300

AIQERLCDQKVLIILDDTNWF

Gene3D: G3DSA:3.40.50.300
265-304 G3DSA:3.40.50.300

DEWEALLDRLETSLDRNVEGALRVGYDSLHVEEQALFRYM

superfamily: SSF52058
358-631 SSF52058,LRR

GRQAIHRQEPRKRHILIDVDEISLENDTDTRAAIGISLDTSGINKVFISEGAFKRMRNLRFLSVYKTRYVQNDQVDIPKDLEFPPHLRLLRWEAYPRNALPTTFHPEYLIELDLQESQLERLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLIIHNCTKLEVVPTLINLASLDFVDMQGCSQLKSLPGISTHISILVIDDTVLEELPTSIILCTRLTSLFIKGSGNFKTLTPLPMSLKYLDLRC

Gene3D: G3DSA:3.80.10.10
393-631 G3DSA:3.80.10.10

ISLDTSGINKVFISEGAFKRMRNLRFLSVYKTRYVQNDQVDIPKDLEFPPHLRLLRWEAYPRNALPTTFHPEYLIELDLQESQLERLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLIIHNCTKLEVVPTLINLASLDFVDMQGCSQLKSLPGISTHISILVIDDTVLEELPTSIILCTRLTSLFIKGSGNFKTLTPLPMSLKYLDLRC

HMMPfam: PF07725
IPR011713
465-484 LRR_3
Leucine-rich repeat 3

YLIELDLQESQLERLWQGTQ

Gene3D: G3DSA:2.30.29.30
IPR011993
876-910 PH_type
Pleckstrin homology-type

DRDIDQALVSLKKGTQLLKYSRKGRPKFRSFRLSP

superfamily: SSF50729
876-959 SSF50729

DRDIDQALVSLKKGTQLLKYSRKGRPKFRSFRLSPAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEIWFAGLKSLIR

HMMPanther: PTHR22870
891-1633 PTHR22870,REGULATOR OF CHROMOSOME CONDENSATION

QLLKYSRKGRPKFRSFRLSPAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEIWFAGLKSLIRQNRNKHAKSEIPEIHDSDCFSTGRPSTASIDFAPNNTRRGRTSIDLGIQNSPTKFGSSDVGYERGNMLRPSTDGFRISVSSTPSCSTGTSGPDDIESLGDVYVWGEVCSDGISQDGTVNCRTVKIDIACGVRHIALVTRQGEVFTWGEEAGGRLGHGIQVDVSRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTMKVACGVWHTVAIVEVMNQTGTSMSSKKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFQQIACGHTLTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKEDRKTPTLVEALKERHVKSISCADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKAGESGYNSNVANRNSTTRSLDGSVRPDRDIRSSKILLSPKTEPVKYSEVRSSRSESSIVRASQVPALQQLRDVAFPSSLSAIQNALKPAASTSTSTLSSGIRSSRRSSPPRSSGFSRSMIDTLKKSNGVINKEMTRLQSQIKNLKEKCDNQGTEIQRL

HMMPanther: PTHR22870:SF25
891-1633 PTHR22870:SF25,REGULATOR OF CHROMOSOME CONDENSATION-RELATED

QLLKYSRKGRPKFRSFRLSPAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEIWFAGLKSLIRQNRNKHAKSEIPEIHDSDCFSTGRPSTASIDFAPNNTRRGRTSIDLGIQNSPTKFGSSDVGYERGNMLRPSTDGFRISVSSTPSCSTGTSGPDDIESLGDVYVWGEVCSDGISQDGTVNCRTVKIDIACGVRHIALVTRQGEVFTWGEEAGGRLGHGIQVDVSRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTMKVACGVWHTVAIVEVMNQTGTSMSSKKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFQQIACGHTLTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKEDRKTPTLVEALKERHVKSISCADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKAGESGYNSNVANRNSTTRSLDGSVRPDRDIRSSKILLSPKTEPVKYSEVRSSRSESSIVRASQVPALQQLRDVAFPSSLSAIQNALKPAASTSTSTLSSGIRSSRRSSPPRSSGFSRSMIDTLKKSNGVINKEMTRLQSQIKNLKEKCDNQGTEIQRL

Gene3D: G3DSA:2.30.29.30
IPR011993
911-965 PH_type
Pleckstrin homology-type

AVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEIWFAGLKSLIRQNRNKH

Gene3D: G3DSA:2.130.10.30
IPR009091
1056-1417 Reg_csome_cond/b-lactamase_inh
Regulator of chromosome condensation/beta-lactamas

SLGDVYVWGEVCSDGISQDGTVNCRTVKIDIACGVRHIALVTRQGEVFTWGEEAGGRLGHGIQVDVSRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTMKVACGVWHTVAIVEVMNQTGTSMSSKKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFQQIACGHTLTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKEDRKTPTLVEALKERHVKSISCADQS

superfamily: SSF50985
IPR009091
1058-1424 RCC1/BLIP-II
Regulator of chromosome condensation/beta-lactamas

GDVYVWGEVCSDGISQDGTVNCRTVKIDIACGVRHIALVTRQGEVFTWGEEAGGRLGHGIQVDVSRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTMKVACGVWHTVAIVEVMNQTGTSMSSKKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFQQIACGHTLTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKEDRKTPTLVEALKERHVKSISCADQSVCSGCRQ

PatternScan: PS00626
IPR000408
1086-1096 RCC1_2
Regulator of chromosome condensation, RCC1

IACGVRHIALV

ProfileScan: PS50012
IPR000408
1100-1151 RCC1_3
Regulator of chromosome condensation, RCC1

GEVFTWGEEAGGRLGHGIQVDVSRPKLVEFLALTNIDFVACGEYHTCAVSTS

HMMPfam: PF00415
IPR000408
1100-1148 RCC1
Regulator of chromosome condensation, RCC1

GEVFTWGEEAGGRLGHGIQVDVSRPKLVEFLALTNIDFVACGEYHTCAV

FPrintScan: PR00633
IPR000408
1102-1118 RCCNDNSATION
Regulator of chromosome condensation, RCC1

VFTWGEEAGGRLGHGIQ

HMMPfam: PF00415
IPR000408
1151-1202 RCC1
Regulator of chromosome condensation, RCC1

SGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSAL

ProfileScan: PS50012
IPR000408
1152-1206 RCC1_3
Regulator of chromosome condensation, RCC1

GDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATAN

FPrintScan: PR00633
IPR000408
1152-1168 RCCNDNSATION
Regulator of chromosome condensation, RCC1

GDLFTWGDGIHNVGLLG

FPrintScan: PR00633
IPR000408
1193-1209 RCCNDNSATION
Regulator of chromosome condensation, RCC1

VACGTWHSALATANGKL

HMMPfam: PF00415
IPR000408
1206-1255 RCC1
Regulator of chromosome condensation, RCC1

NGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTMKVACGVWHTVAI

ProfileScan: PS50012
IPR000408
1207-1258 RCC1_3
Regulator of chromosome condensation, RCC1

GKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTMKVACGVWHTVAIVEV

FPrintScan: PR00633
IPR000408
1209-1223 RCCNDNSATION
Regulator of chromosome condensation, RCC1

LFTFGDGAFGVLGHG

PatternScan: PS00626
IPR000408
1245-1255 RCC1_2
Regulator of chromosome condensation, RCC1

VACGVWHTVAI

ProfileScan: PS50012
IPR000408
1269-1320 RCC1_3
Regulator of chromosome condensation, RCC1

KKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFQQIACGHTLTVALTTS

HMMPfam: PF00415
IPR000408
1271-1317 RCC1
Regulator of chromosome condensation, RCC1

LFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFQQIACGHTLTVAL

FPrintScan: PR00633
IPR000408
1310-1328 RCCNDNSATION
Regulator of chromosome condensation, RCC1

GHTLTVALTTSGHVFTMGG

HMMPfam: PF00415
IPR000408
1320-1369 RCC1
Regulator of chromosome condensation, RCC1

SGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVL

ProfileScan: PS50012
IPR000408
1321-1372 RCC1_3
Regulator of chromosome condensation, RCC1

GHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSR

FPrintScan: PR00633
IPR000408
1368-1389 RCCNDNSATION
Regulator of chromosome condensation, RCC1

VLTSRSEVFTWGKGSNGRLGHG

ProfileScan: PS50012
IPR000408
1373-1424 RCC1_3
Regulator of chromosome condensation, RCC1

SEVFTWGKGSNGRLGHGDKEDRKTPTLVEALKERHVKSISCADQSVCSGCRQ

HMMPfam: PF00415
IPR000408
1374-1417 RCC1
Regulator of chromosome condensation, RCC1

EVFTWGKGSNGRLGHGDKEDRKTPTLVEALKERHVKSISCADQS

HMMSmart: SM00064
IPR000306
1408-1476 FYVE
Zinc finger, FYVE-type

VKSISCADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKA

superfamily: SSF57903
IPR011011
1412-1480 FYVE_PHD_ZnF
Zinc finger, FYVE/PHD-type

SCADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKAGESG

ProfileScan: PS50178
IPR017455
1413-1475 ZF_FYVE
Zinc finger, FYVE-related

CADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLK

HMMPfam: PF01363
IPR000306
1414-1475 FYVE
Zinc finger, FYVE-type

ADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLK

Gene3D: G3DSA:3.30.40.10
IPR013083
1418-1475 Znf_RING/FYVE/PHD
Zinc finger, RING/FYVE/PHD-type

VCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLK

HMMPfam: PF13713
1647-1682 BRX_N,Transcription factor BRX N-terminal domain

HSSKHKAATEVMKSVAEHLRELKEKLPPEVSGCEAF

HMMPfam: PF08381
IPR013591
1756-1812 BRX
Brevis radix-like domain

GKELIEQFEPGVYVTYVLHKNGGKIFRRVRFSKRRFDEHQAEEWWNSKKDRLLKRYS

ProfileScan: PS51514
IPR013591
1757-1812 BRX
Brevis radix-like domain

KELIEQFEPGVYVTYVLHKNGGKIFRRVRFSKRRFDEHQAEEWWNSKKDRLLKRYS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox