PRGDB00144207 (493178)

From PRG Wiki
Jump to: navigation, search
493178
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TN
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis lyrata

Comment?

disease resistance protein (TIR-NBS class), putative (best arabidopsis hit)

DNA Sequence

ATGAAGTCTTCTTCTTCTTCTTCATCTTCTCGTTGCTGGAGATACGATGTTTTCCCAAACTTCAGAGGGGAAGATGTCCGCCAATCATTAATCAGCCATCTTCGTAAGGAACTTGATGGCAAATTAGTCAATACATTCAACGACACCAGGATCGAAAGAAGCCGCAAAATAAACCCAGAGCTTTTATTGGCGATAGAAGGGTCTAGGATCTCACTTGTCGTCTTCTCTAAAAACTATGCTTCTTCCACGTGGTGCTTAGATGAATTGGTGAAGATCCAAGAGTGCCATGAGCAGTTGGATCAAATGGTGATTCCTATTTTCTACAACGTAGATCCCTCTCATGTTAGAAAACAGACCGGAGAGTTTGGTAAGGTCTTTGTAGAGACCTGCAAGGGCAGAACAGAGAATGAGAAGCGAAAATGGATGCGAGCTCTAACAGAGGTAGCAAATCTAGCCGGTGAAGATCTTCGGAATGGGCGTAGCGAAGCAGAAATGCTTGAAAACATTGCCAAAGATGTTTTAAACAAACTTATTACCCCATCAGATAATTTCAGTGACTTCGTCGGGATTGGAGCTCATATAGAGACATTGATATCAATGTTGCGCTTCGACTCAGAGAAAGCGCGAATGATAGGGATTTGTGGGCCTTCCGAAACTGGTAAGACTACCATAGGAAGAGCTCTATACAGCAAAATCAAAAGCCACTTCCACCATCGGGCTTTCGTAGCATACAAGAGAACAATGCCGAGCGATTATGACCAGAAGTTGTATTGGGAAGAACAATTTCTATCAGAAATTCTTTGTCAAAAGAATATAAAGATAGAGGAATGTGGTGTGGTGGAACAACGACTAAAGCACAAGAAAGTTCTTATTGTTCTTGATGATGTCGATGATATTGAGCTACTAAAAACGTTGGTAGGACGAATCAGATGGTTTGGATCTGAGAGCAAAATTGTTGTGATTACTAAAAAAAGGGAACTTCTCAAAGCTCACAAGATTGCACATGTTTATGAAGTGGAATTCCCATCAGAAGAAATGGCTCATCAAATGTTTTGTCGATATGCTTTTGGGAAAAACTCCCCACCTCATGGTTTCAGCGAGCTTGCATTTGAAGCTGCAAAGCTTGCCGGTAATCGTCCTAAAGCTCTGAAGCACTTTGGCTCGTCTTTTAGAAGGATATCGGACAAGGAAGAGTGGGCGAAGATTCTATCGGTACTCTGTAATGAGAATAAACTAAAAATCAGCTATGATGGGTTAGATGGCAAAGGTCAAGGTTACATTGCGTGTTTAACCAATGTGAAGGCAGAGTGGATCCACTTGGCACTAGGCGTGTCTATATTACTTAATATCCGCAGTGACGGAACGACATTTCTCAAACATTTGAGCTACAATCGAAGCGTGGCGCAACAAGCAAAAATATGGTGGTACGAGAATTGTGAAAGAGTGTACAAGAAGTACAATATATGTGGCATAGATAGCTCAACTGATGGTGGTGGTAAGAAAGTTTGTGACGGTGGGTTAGACGGCAAAGATCAAGGTTCAACGTATGGACAAAGTTCAAATTCTGAGCTTCAAATAAACATGGACGCAAGCAATAGGAGATATGAACCTGTGAGTGAGACGCTTTTCAAAAATTACGATGCGTATTTGCCGAATGGTTTAACGGATGGAAACTGTTCAAATACCCAGCCTCAAAGAAAATTGGACGCAAGCCTAAAGAAAGACAAAATTGTGCATGAGTGGATTCGAACCGGTAGTGGCTTCTCTTTTGATTTTCAGGGCCCAAAATCTATAGTGAGTGCTGCTCAAGTGGAGGAGAAAAAGATCGAGTGTGGAGAAGGCGTGTACATAACACTTGGCAGGCTCAGTGGCGGAATTATAGTCCTCAAACATTTGGAGTTCAGCCGAAGAGTGGCGCAACAAGCAAAAGTTTGGTGGTCGGAAAATTGGATAAAAGTGTACGAGGAGCACAACATCTGTGGCATAGATAAATCATTTGATGGTAGGTTTGATGATAGACGTGTCATTTGTCAATTAAGACCAAACTGA


Protein sequences

Name Description Sequence
493178 disease resistance protein (TIR-NBS class), putative (best arabidopsis hit)

MKSSSSSSSSRCWRYDVFPNFRGEDVRQSLISHLRKELDGKLVNTFNDTRIERSRKINPELLLAIEGSRISLVVFSKNYASSTWCLDELVKIQECHEQLDQMVIPIFYNVDPSHVRKQTGEFGKVFVETCKGRTENEKRKWMRALTEVANLAGEDLRNGRSEAEMLENIAKDVLNKLITPSDNFSDFVGIGAHIETLISMLRFDSEKARMIGICGPSETGKTTIGRALYSKIKSHFHHRAFVAYKRTMPSDYDQKLYWEEQFLSEILCQKNIKIEECGVVEQRLKHKKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITKKRELLKAHKIAHVYEVEFPSEEMAHQMFCRYAFGKNSPPHGFSELAFEAAKLAGNRPKALKHFGSSFRRISDKEEWAKILSVLCNENKLKISYDGLDGKGQGYIACLTNVKAEWIHLALGVSILLNIRSDGTTFLKHLSYNRSVAQQAKIWWYENCERVYKKYNICGIDSSTDGGGKKVCDGGLDGKDQGSTYGQSSNSELQINMDASNRRYEPVSETLFKNYDAYLPNGLTDGNCSNTQPQRKLDASLKKDKIVHEWIRTGSGFSFDFQGPKSIVSAAQVEEKKIECGEGVYITLGRLSGGIIVLKHLEFSRRVAQQAKVWWSENWIKVYEEHNICGIDKSFDGRFDDRRVICQLRPN*

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-154 TIR
Toll-Interleukin receptor

SSSSSSSSRCWRYDVFPNFRGEDVRQSLISHLRKELDGKLVNTFNDTRIERSRKINPELLLAIEGSRISLVVFSKNYASSTWCLDELVKIQECHEQLDQMVIPIFYNVDPSHVRKQTGEFGKVFVETCKGRTENEKRKWMRALTEVANLAGE

Gene3D: G3DSA:3.40.50.10140
12-149 G3DSA:3.40.50.10140

CWRYDVFPNFRGEDVRQSLISHLRKELDGKLVNTFNDTRIERSRKINPELLLAIEGSRISLVVFSKNYASSTWCLDELVKIQECHEQLDQMVIPIFYNVDPSHVRKQTGEFGKVFVETCKGRTENEKRKWMRALTEVA

ProfileScan: PS50104
IPR000157
13-151 TIR
Toll-Interleukin receptor

WRYDVFPNFRGEDVRQSLISHLRKELDGKLVNTFNDTRIERSRKINPELLLAIEGSRISLVVFSKNYASSTWCLDELVKIQECHEQLDQMVIPIFYNVDPSHVRKQTGEFGKVFVETCKGRTENEKRKWMRALTEVANL

HMMSmart: SM00255
IPR000157
14-151 TIR
Toll-Interleukin receptor

RYDVFPNFRGEDVRQSLISHLRKELDGKLVNTFNDTRIERSRKINPELLLAIEGSRISLVVFSKNYASSTWCLDELVKIQECHEQLDQMVIPIFYNVDPSHVRKQTGEFGKVFVETCKGRTENEKRKWMRALTEVANL

HMMPfam: PF01582
IPR000157
17-146 TIR
Toll-Interleukin receptor

VFPNFRGEDVRQSLISHLRKELDGKLVNTFNDTRIERSRKINPELLLAIEGSRISLVVFSKNYASSTWCLDELVKIQECHEQLDQMVIPIFYNVDPSHVRKQTGEFGKVFVETCKGRTENEKRKWMRALT

superfamily: SSF52540
68-363 SSF52540

SRISLVVFSKNYASSTWCLDELVKIQECHEQLDQMVIPIFYNVDPSHVRKQTGEFGKVFVETCKGRTENEKRKWMRALTEVANLAGEDLRNGRSEAEMLENIAKDVLNKLITPSDNFSDFVGIGAHIETLISMLRFDSEKARMIGICGPSETGKTTIGRALYSKIKSHFHHRAFVAYKRTMPSDYDQKLYWEEQFLSEILCQKNIKIEECGVVEQRLKHKKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITKKRELLKAHKIAHVYEVEFPSEEMAHQMFCRYAFGKNSPPH

Gene3D: G3DSA:3.40.50.300
182-316 G3DSA:3.40.50.300

DNFSDFVGIGAHIETLISMLRFDSEKARMIGICGPSETGKTTIGRALYSKIKSHFHHRAFVAYKRTMPSDYDQKLYWEEQFLSEILCQKNIKIEECGVVEQRLKHKKVLIVLDDVDDIELLKTLVGRIRWFGSES

HMMPfam: PF00931
IPR002182
192-410 NB-ARC,NBS
NB-ARC

AHIETLISMLRFDSEKARMIGICGPSETGKTTIGRALYSKIKSHFHHRAFVAYKRTMPSDYDQKLYWEEQFLSEILCQKNIKIEECGVVEQRLKHKKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITKKRELLKAHKIAHVYEVEFPSEEMAHQMFCRYAFGKNSPPHGFSELAFEAAKLAGNRPKALKHFGSSFRRISDKEEWAKILSVLCNEN

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

MIGICGPSETGKTTIG

FPrintScan: PR00364
IPR000767
283-297 DISEASERSIST
Disease resistance protein

RLKHKKVLIVLDDVD

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

AGNRPKALKHFGSSF

HMMPfam: PF08381
IPR013591
433-487 BRX
Brevis radix-like domain

VKAEWIHLALGVSILLNIRSDGTTFLKHLSYNRSVAQQAKIWWYENCERVYKKYN

ProfileScan: PS51514
IPR013591
435-487 BRX
Brevis radix-like domain

AEWIHLALGVSILLNIRSDGTTFLKHLSYNRSVAQQAKIWWYENCERVYKKYN

HMMPanther: PTHR22870
450-682 PTHR22870,REGULATOR OF CHROMOSOME CONDENSATION

IRSDGTTFLKHLSYNRSVAQQAKIWWYENCERVYKKYNICGIDSSTDGGGKKVCDGGLDGKDQGSTYGQSSNSELQINMDASNRRYEPVSETLFKNYDAYLPNGLTDGNCSNTQPQRKLDASLKKDKIVHEWIRTGSGFSFDFQGPKSIVSAAQVEEKKIECGEGVYITLGRLSGGIIVLKHLEFSRRVAQQAKVWWSENWIKVYEEHNICGIDKSFDGRFDDRRVICQLRPN

HMMPanther: PTHR22870:SF61
450-682 PTHR22870:SF61,DISEASE RESISTANCE PROTEIN (TIR-NBS CLASS)

IRSDGTTFLKHLSYNRSVAQQAKIWWYENCERVYKKYNICGIDSSTDGGGKKVCDGGLDGKDQGSTYGQSSNSELQINMDASNRRYEPVSETLFKNYDAYLPNGLTDGNCSNTQPQRKLDASLKKDKIVHEWIRTGSGFSFDFQGPKSIVSAAQVEEKKIECGEGVYITLGRLSGGIIVLKHLEFSRRVAQQAKVWWSENWIKVYEEHNICGIDKSFDGRFDDRRVICQLRPN

ProfileScan: PS51514
IPR013591
605-658 BRX
Brevis radix-like domain

EEKKIECGEGVYITLGRLSGGIIVLKHLEFSRRVAQQAKVWWSENWIKVYEEHN

HMMPfam: PF08381
IPR013591
605-658 BRX
Brevis radix-like domain

EEKKIECGEGVYITLGRLSGGIIVLKHLEFSRRVAQQAKVWWSENWIKVYEEHN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox