PRGDB00146965 (Bradi3g51400.1)

From PRG Wiki
Jump to: navigation, search
Bradi3g51400.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CN
Domain Type NBS, Ser-Thr Kinase
Gene Species Ricinus communis

Comment?

U-box domain-containing protein kinase family protein (best arabidopsis hit); protein kinase, putative, expressed (best rice hit)

DNA Sequence

ATGGAGGAGACCGGCGCCGGGGGCGCAGTGTACCGGCGGTGGGACACGTCGGGCAGCGGGTCGCGGTACAGCTTCAGGACGTCGGTGAGCAGCCTGGCGGAGATGGACGGCGAGGTAGTGGAGGAGGAGACGCTGGTGAACCAGCAGGCAGAGGCTGCAGGAGCTGAGGACGACAGGGTGTTCGTGGCCGTCCCGCAAGAGGTCAAGCACGGGAAGAGCGCCCTGTTGTGGGCGCTGCAGAACCTGGCCAAGGACGGCGCGCGCGTCGTCCTGGCTCACGTGCACTGCCCCTCGCAGATGATCCCCATGATGGGAGCGAAAATTCATTATACCAGGATGAATCCAGAACAGGTCAAGGACCACAGAGAAAAGGAGCGACAAAAAGCATCCGAAAAACTAGATGAATACGTTGTGATGTGCACAACACTAAAGGTCAGCTGTGAAAAAATAATGATTGATAAGGATGATGTTGCTAAAGGACTTGAGGAGCTTATTGCCCTTCATGGCATCACCAAACTTGTTATGGGAGCAGCATCAGACAAAAATTACTCGAAGAAACTGAAAACACCAAAGTCCAAGACATCACTCAGACTGATGGAGGCAGGAGCCCCATCGTGTAAGATATGGTTTACTTGTAAAGGAATTCTGATATGTACCAGGGAAGCAAACACAACTGTTCCTGCGGTACCACCATCACCTGCACCCACGGTTGCATCAACATTGTCCGAGAACAGCATTTCCAGCCATATGAGATCATTAACAATTCACCACACAGAGAGTGAAGCATCAAGCTCAAACGGAAGTCCCAAGCAGGGACTGAACAGATCGGTAACAGCAGTGCCACGTCATACCTCTCGGGCAGCTGGCAGTACACCATCTAGGCTATTTGAACCTTTCAAACTCAATGCAAACAGCAGGCCACCAAGAACACCGATGAGTTCTCTAGATTCCTGGGATGATTTTGGGAGGAGATCGGAAAGCTCCTGGTACAATTTATCGAGAAATGGTGATGCAACCAGTGTCTCTGAATCAGCAATGCAGCATCCATTGAATGAATCTGATGATGACCGCCTTTCATCTCCTTCTCATGAGCTGGAGAGTTCAGGTGTTGATGCAGAAATGTATGCTAGACTTGAAGAGGCTCTCCGCGAATCTCAAGAATCCAAGAAAGAAGCATTTGAGGAATCAACCAAGCGCCGAAAAGCCGACCATGAGTTGTTTTCAGCTCTTCACAAGATTGTAAAGCGTGTAATTCAAACCAACGAAGACAAACTACTCTTGCAGGCCAAGGAGTTGGAGAAATTGTATCATCACGAGATAAGACAGCGGAAAACAATTGAGGAGACACTACTGAGACAGACGCAGGAGATTCAAGAAATGACAATTCTGCGTGACACAATATACAATGACTTGCATGATGCAGAAGAACAGAAGATCATATTGGAGCAGTGTGTAACCAAGACAAAATCTACTCTAGAAAGTCATGAAGAGAAGCTGGCAACAAGCAAGTACCTTATCGAAGTGCTCCAAGCAGACAAAGTGAAGCTCCAACAAGAGAGGGATGCTGCGGTAACCGCCGCTGAAGAGTTGCGTCAGAAGAACGAGCAGAGAATTTCCATGCCGACTGAAGCACTAAACACCGAGTTCTCAGCCTTTGAGCTTGAACAAGCAACTCGATGCTTTGATGAAGCGCTGAAGATCGGCAAGGGCGGGTTCGGATGTGTCTACAAAGGCTCACTTCGCAACACAACCGTGGCTATAAAGTTGCTGCATCCAGAGAGCTTGCAGGGGCAGTCGGAATTCAACCAAGAGGTTGCTGTCCTGGGTAGAGTGCGGCACCCGAACCTCGTCGCGCTGATCGGGTCGTGCCGGGAGACGTTCGGCCTGGTGTACGAGTTCCTCCCGAACGGCAGCCTGGAGCACCGGCTGGCCTGCACGAACAACACGAGACCCCTAACATGGCAGGTGCGCACCAGGATCATCTACGAGATGTGCTCGGCCCTGAGCTTCCTCCACTCCAACAAGCCGCACCCGGTGGTCCACGGGGACCTGAAGCCGGCCAACATCCTCCTGGACGCCAACTTGGTCAGCAAGCTGGGGGATTTCGGCATCTGCCGCTTCCTGACGCAGTCCAACGCCTCCGCCACCACCACGCTGCACCGGACGACCACCCCACGGGGAACCTTCGCGTACATGGACCCGGAGTTACTGTCCACCGGCGAGATAACCCCGCGCTCCGACGTCTACTCCTTCGGCATCATCATCCTGCAGCTCCTGACGGGGAGGCCGCCCCAGAAGATCGCCGAGGTGGTGGAGGACGCGGTGGTGAATAGGGATCTGCACAGCATCCTGGATCCCTCCGCGGGGAGCTGGCCGTTCGTGCAGGCCAACCAGCTCGCGCACCTCGGCCTGCGCTGCGCCGAGATGAGCAGGAGGCGCCGCCCGGATCTCGCCCGGGACGTGTGGATGGTGGTGGAGCCCCTGATGAAGGCCGCGTCGCTGACCGCCGGGCGGCCCACGTTCGCAGCAGCCTCCAGGGGTGAAGCTTCCACGCCGTCCTACTTCGTCTGCCCGATCTTTCAGGAGTTGATGAATGATCCTCACATCGCAGCGGATGGGTTCACCTACGAAGCGGAAGCCATCAGAGGGTGGCTGGACAGCGGGCACGACACGTCGCCGATGACGAACCTGAAGCTCGCGCACCGCGAGCTCACCCCAAACAGGGGGCTCCGCTCGGTGATTCTCGAGTGGCAACAGCAACAGCGTCAGCAGGAGTTGGATGAGGACTGGAGGTTCCTTGTTCCAATACCCAAAAAGGGTCCCCTGCACCTTTGA


Protein sequences

Name Description Sequence
Bradi3g51400.1 U-box domain-containing protein kinase family protein (best arabidopsis hit); protein kinase, putative, expressed (best rice hit)

MEETGAGGAVYRRWDTSGSGSRYSFRTSVSSLAEMDGEVVEEETLVNQQAEAAGAEDDRVFVAVPQEVKHGKSALLWALQNLAKDGARVVLAHVHCPSQMIPMMGAKIHYTRMNPEQVKDHREKERQKASEKLDEYVVMCTTLKVSCEKIMIDKDDVAKGLEELIALHGITKLVMGAASDKNYSKKLKTPKSKTSLRLMEAGAPSCKIWFTCKGILICTREANTTVPAVPPSPAPTVASTLSENSISSHMRSLTIHHTESEASSSNGSPKQGLNRSVTAVPRHTSRAAGSTPSRLFEPFKLNANSRPPRTPMSSLDSWDDFGRRSESSWYNLSRNGDATSVSESAMQHPLNESDDDRLSSPSHELESSGVDAEMYARLEEALRESQESKKEAFEESTKRRKADHELFSALHKIVKRVIQTNEDKLLLQAKELEKLYHHEIRQRKTIEETLLRQTQEIQEMTILRDTIYNDLHDAEEQKIILEQCVTKTKSTLESHEEKLATSKYLIEVLQADKVKLQQERDAAVTAAEELRQKNEQRISMPTEALNTEFSAFELEQATRCFDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDLARDVWMVVEPLMKAASLTAGRPTFAAASRGEASTPSYFVCPIFQELMNDPHIAADGFTYEAEAIRGWLDSGHDTSPMTNLKLAHRELTPNRGLRSVILEWQQQQRQQELDEDWRFLVPIPKKGPLHL*

Domains

Domain Start-End Description Sequence

superfamily: SSF52402
55-177 Adenine nucleotide alpha hydrolases-like

AEDDRVFVAVPQEVKHGKSALLWALQNLAKDGARVVLAHVHCPSQMIPMMGAKIHYTRMNPEQVKDHREKERQKASEKLDEYVVMCTTLKVSCEKIMIDKDDVAKGLEELIALHGITKLVMGA

Gene3D: G3DSA:3.40.50.620
IPR014729
59-178 no description
Rossmann-like alpha/beta/alpha sandwich fold

RVFVAVPQEVKHGKSALLWALQNLAKDGARVVLAHVHCPSQMIPMMGAKIHYTRMNPEQVKDHREKERQKASEKLDEYVVMCTTLKVSCEKIMIDKDDVAKGLEELIALHGITKLVMGAA

HMMPfam: PF00582
IPR006016
67-179 Usp
UspA

EVKHGKSALLWALQNLAKDGARVVLAHVHCPSQMIPMMGAKIHYTRMNPEQVKDHREKERQKASEKLDEYVVMCTTLKVSCEKIMIDKDDVAKGLEELIALHGITKLVMGAAS

HMMPanther: PTHR24420
180-897 FAMILY NOT NAMED,FAMILY NOT NAMED

DKNYSKKLKTPKSKTSLRLMEAGAPSCKIWFTCKGILICTREANTTVPAVPPSPAPTVASTLSENSISSHMRSLTIHHTESEASSSNGSPKQGLNRSVTAVPRHTSRAAGSTPSRLFEPFKLNANSRPPRTPMSSLDSWDDFGRRSESSWYNLSRNGDATSVSESAMQHPLNESDDDRLSSPSHELESSGVDAEMYARLEEALRESQESKKEAFEESTKRRKADHELFSALHKIVKRVIQTNEDKLLLQAKELEKLYHHEIRQRKTIEETLLRQTQEIQEMTILRDTIYNDLHDAEEQKIILEQCVTKTKSTLESHEEKLATSKYLIEVLQADKVKLQQERDAAVTAAEELRQKNEQRISMPTEALNTEFSAFELEQATRCFDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDLARDVWMVVEPLMKAASLTAGRPTFAAASRGEASTPSYFVCPIFQELMNDPHIAADGFTYEAEAIRGWLDSGHDTSPMTNL

HMMPanther: PTHR24420:SF448
180-897 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DKNYSKKLKTPKSKTSLRLMEAGAPSCKIWFTCKGILICTREANTTVPAVPPSPAPTVASTLSENSISSHMRSLTIHHTESEASSSNGSPKQGLNRSVTAVPRHTSRAAGSTPSRLFEPFKLNANSRPPRTPMSSLDSWDDFGRRSESSWYNLSRNGDATSVSESAMQHPLNESDDDRLSSPSHELESSGVDAEMYARLEEALRESQESKKEAFEESTKRRKADHELFSALHKIVKRVIQTNEDKLLLQAKELEKLYHHEIRQRKTIEETLLRQTQEIQEMTILRDTIYNDLHDAEEQKIILEQCVTKTKSTLESHEEKLATSKYLIEVLQADKVKLQQERDAAVTAAEELRQKNEQRISMPTEALNTEFSAFELEQATRCFDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDLARDVWMVVEPLMKAASLTAGRPTFAAASRGEASTPSYFVCPIFQELMNDPHIAADGFTYEAEAIRGWLDSGHDTSPMTNL

Seg: seg
184-196 seg

SKKLKTPKSKTSL

Seg: seg
224-240 seg

TTVPAVPPSPAPTVAST

Coil: coil
375-396 coiled-coil

YARLEEALRESQESKKEAFEES

Seg: seg
422-435 seg

EDKLLLQAKELEKL

Coil: coil
506-537 coiled-coil

IEVLQADKVKLQQERDAAVTAAEELRQKNEQR

superfamily: SSF56112
IPR011009
533-847 Protein kinase-like (PK-like)
Protein kinase-like domain

KNEQRISMPTEALNTEFSAFELEQATRCFDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDLARDVWMVVEPLMKAASLTAGRPTFAAASRG

Gene3D: G3DSA:3.30.200.20
545-620 no description

LNTEFSAFELEQATRCFDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALI

HMMSmart: SM00219
IPR020635
561-824 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDLARDVWMV

ProfileScan: PS50011
IPR000719
561-829 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDLARDVWMVVEPLM

HMMSmart: SM00220
IPR002290
561-823 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDLARDVWM

HMMPfam: PF00069
IPR000719
566-817 Pkinase,Ser-thr
Protein kinase, catalytic domain

KIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSEFNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDL

PatternScan: PS00107
IPR017441
567-588 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGGFGCVYKGSLRNTTVAIK

Gene3D: G3DSA:1.10.510.10
621-816 no description

GSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRIIYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLHRTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDLHSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPD

PatternScan: PS00108
IPR008271
679-691 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHGDLKPANILL

Seg: seg
716-728 seg

TTTLHRTTTPRGT

superfamily: SSF57850
833-930 RING/U-box,NBS

SLTAGRPTFAAASRGEASTPSYFVCPIFQELMNDPHIAADGFTYEAEAIRGWLDSGHDTSPMTNLKLAHRELTPNRGLRSVILEWQQQQRQQELDEDW

Gene3D: G3DSA:3.30.40.10
IPR013083
851-921 no description
Zinc finger, RING/FYVE/PHD-type

TPSYFVCPIFQELMNDPHIAADGFTYEAEAIRGWLDSGHDTSPMTNLKLAHRELTPNRGLRSVILEWQQQQ

HMMPfam: PF04564
IPR003613
852-922 U-box
U box domain

PSYFVCPIFQELMNDPHIAADGFTYEAEAIRGWLDSGHDTSPMTNLKLAHRELTPNRGLRSVILEWQQQQR

HMMSmart: SM00504
IPR003613
854-917 Modified RING finger domain
U box domain

YFVCPIFQELMNDPHIAADGFTYEAEAIRGWLDSGHDTSPMTNLKLAHRELTPNRGLRSVILEW

Seg: seg
915-931 seg

LEWQQQQRQQELDEDWR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox