PRGDB00147024 (Bradi4g03230.1)

From PRG Wiki
Jump to: navigation, search
Bradi4g03230.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Ricinus communis

Comment?

ADR1-like 1 (best arabidopsis hit); disease resistance protein, putative, expressed (best rice hit)

DNA Sequence

ATGGAGAGGATCCTGTTCGAGGAGCTGGCCGGCGACGCGGTGCGGGAGCTGCTGCGCGCCGTGCGGGGCACCTTCCTCTGCCGCTCCACCGCCGAGCGCCTCCGCCGCACCGTCGAGCCGCTCCTCCCCCTCGTCCAGTCCCACGGCCACGGCCACCACGGCCACCCGCTGCGCAGCAACGCCGAGCTGGGCGAGCTGGCCGTGCAGCTCCGGGACGCGCTCGACCTCGCCCGCCGCGCCGCCGCCGCGCCCCGCTGGAACGTCTACCGCTCCGCCCAGCTGGCCCGCCGCATGGAGGCCGCCGACAGCGGCATCGCGCGCTGGCTGGCCCGCCACGCGCCCGCGCACGTGCTCGACGGCGTCCGCCGCTTACGGGACGAGGCTGATGCTCGCATCGGCCGCCTCGAGCGCCGCGTCGAGGAGGTCGCCGCCGCCATGCAGGCGCCTCCAGTACCCGCCGTGGTCGCGCCGGCGGCCCCGTGCAAGGGCGTGGCCATGGCGGTGGAGCCGGCGCCGGGGAAGGCCATGGGGTTGCCGATGGATCTGGAGCCACCGGAGATGGAGGAAGAGGAGAAGGAGGTGGCCGTGGGAGGGGGAGTCAAGGTGGGGAAAGAGAAGGTGAAGGAGATGGTGATGAGCGGCGGCGGATGGGAGGTCGTCGGGATCTGCGGCATGGGCGGCAGCGGCAAGACCACGCTCGCCATGGAGATCTTCAAGGACCAAAAAGTCCAAGCCTACTTCAACAATAGGGTCTTCTTTGAGACGGTCTCGCAATCCGCAAATCTGGAGACCATCAAGATGAAGCTGTGGGAGCAGATCAGCAGCGACATTGTGCTTGGTCAATATAACCAGATACCTGAATGGCAGCTCAGGTTAGGGCCAAGGGATCGAGGACCGGTCCTTGTTATACTTGATGATGTGTGGTCTCTCTCACAGCTCGAGGACCTAGTCTTCAAGTTCCCTGGGTGCAAGACCCTTGTCGTATCGAGGTTCAAGTTCCCCACAATAGTCACCCGGACTTATGAAATGAAATTACTCGGCGAGGAGGAGGCCTTGTCTGTCTTCTGCCGTGCCGCCTTTGACCAGGAGTCTGTTCCTCAGACTGCTGACAAGAAACTCGTTAGGCAGGTTGCTGCCGAGTGCAGAGGGCTTCCGCTAGCTCTCAAGGTCATTGGTGCATCCTTGCGGGGCCAGCCTCCTATGATATGGTTGAGCGCAAAGAACCGCTTGTCACGAGGAGAGTCTATTTCTGACTCACATGAGACCAAACTCCTGGAGAGAATGGCAGCAAGCATTGAGTGCTTGTCAGGAAAAGTTAGAGAATGTTTCCTTGATCTGGGTTGCTTCCCGGAGGATAAGAAGATCCCTCTTGATGTGCTGATCAACATTTGGATGGAGATACATGACCTTGATGAGCCAGATGCTTTCGCCATCCTGACCGAGCTGTCGAACAAGAATCTACTTACCCTGGTCAATGACGCACAGAACAAAGCTGGAGATATATACAGTAGCTACCATGACTACTCAGTGACGCAACACGATGTGTTGCGGGATCTAGCACTTCACATGAGCGGCAGTGATTCTCTGAACAAACGAAGGAGGTTAGTGATGCCGAGAAGAGAAGAATCACTCCCAAGAGATTGGCAGAGGAATAAGGACACTCCGTTTGAAGCTCAGATTGTTTCCATTCATACAGGTGAGATGAAAGAATCTGACTGGTTCCAGATGAAATTCCCCAAGGCAGAAGTTCTCATCCTCAACTTTGCCTCTAGTGTGTACTACCTCCCACCGTTCATCGCAACTATGCAGAACCTGAAGGCCCTAGTGCTTATCAACTACGGCACTGCCAGCGCAGCCCTTGACAATTTATCTGCCTTCACCATGCTCAGCGACCTGAGGAGCCTCTGGCTGGAGAAGATTACACTTCCGCCACTGCCAAAAACCACGATCCCGCTGAAGAACCTGCGCAAGATCTCTCTTGTCCTTTGTGAGCTGAACGACAGTCTAAGAGGATCAACAATGGACCTCTCAATGACGTTCCCGCGCCTGTCCAACCTCACCATTGACCATTGCGTAGATCTGAAGGAGTTGCCACCTACCATATGTGAAATCAGCTCCCTGGAAAGAATCTCCATCTCAAACTGCCATGACCTCACAGAGCTGCCATATGAGCTGGGCAAGTTGCACTGCCTGAGCATCCTACGGGTGTACGCCTGCCCGGCACTGTGGAAGCTCCCCCCATCGGTATGCAGCCTGAAGAGGCTGAAATACCTTGACGTATCTCAGTGCATTAACCTTACAGATCTCCCGGAGGAACTTGGTCACTTGACAAACCTAGAGAAGATCGACATGCGGGAATGCTCGCGGTTGAGGAGCCTTCCGAGGTCCTCCTCGTCGCTGAAGTCCCTCGGGCACGTGGTGTGCGATGAGGAGACGGCATTGCTGTGGAGGGAAGCCGAGCAGGTCATCCCAGACCTCCGGGTGCAGGTAGCAGAAGAGTGTTATAACCTAGACTGGCTTGTAGACTGA


Protein sequences

Name Description Sequence
Bradi4g03230.1 ADR1-like 1 (best arabidopsis hit); disease resistance protein, putative, expressed (best rice hit)

MERILFEELAGDAVRELLRAVRGTFLCRSTAERLRRTVEPLLPLVQSHGHGHHGHPLRSNAELGELAVQLRDALDLARRAAAAPRWNVYRSAQLARRMEAADSGIARWLARHAPAHVLDGVRRLRDEADARIGRLERRVEEVAAAMQAPPVPAVVAPAAPCKGVAMAVEPAPGKAMGLPMDLEPPEMEEEEKEVAVGGGVKVGKEKVKEMVMSGGGWEVVGICGMGGSGKTTLAMEIFKDQKVQAYFNNRVFFETVSQSANLETIKMKLWEQISSDIVLGQYNQIPEWQLRLGPRDRGPVLVILDDVWSLSQLEDLVFKFPGCKTLVVSRFKFPTIVTRTYEMKLLGEEEALSVFCRAAFDQESVPQTADKKLVRQVAAECRGLPLALKVIGASLRGQPPMIWLSAKNRLSRGESISDSHETKLLERMAASIECLSGKVRECFLDLGCFPEDKKIPLDVLINIWMEIHDLDEPDAFAILTELSNKNLLTLVNDAQNKAGDIYSSYHDYSVTQHDVLRDLALHMSGSDSLNKRRRLVMPRREESLPRDWQRNKDTPFEAQIVSIHTGEMKESDWFQMKFPKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTASAALDNLSAFTMLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELNDSLRGSTMDLSMTFPRLSNLTIDHCVDLKELPPTICEISSLERISISNCHDLTELPYELGKLHCLSILRVYACPALWKLPPSVCSLKRLKYLDVSQCINLTDLPEELGHLTNLEKIDMRECSRLRSLPRSSSSLKSLGHVVCDEETALLWREAEQVIPDLRVQVAEECYNLDWLVD*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-147 RPW8
Powdery mildew resistance protein, RPW8 domain

MERILFEELAGDAVRELLRAVRGTFLCRSTAERLRRTVEPLLPLVQSHGHGHHGHPLRSNAELGELAVQLRDALDLARRAAAAPRWNVYRSAQLARRMEAADSGIARWLARHAPAHVLDGVRRLRDEADARIGRLERRVEEVAAAMQ

Seg: seg
70-83 seg

LRDALDLARRAAAA

Coil: coil
118-146 coiled-coil

LDGVRRLRDEADARIGRLERRVEEVAAAM

Seg: seg
142-165 seg

VAAAMQAPPVPAVVAPAAPCKGVA

superfamily: SSF52540
177-397 P-loop containing nucleoside triphosphate hydrolases

GLPMDLEPPEMEEEEKEVAVGGGVKVGKEKVKEMVMSGGGWEVVGICGMGGSGKTTLAMEIFKDQKVQAYFNNRVFFETVSQSANLETIKMKLWEQISSDIVLGQYNQIPEWQLRLGPRDRGPVLVILDDVWSLSQLEDLVFKFPGCKTLVVSRFKFPTIVTRTYEMKLLGEEEALSVFCRAAFDQESVPQTADKKLVRQVAAECRGLPLALKVIGASLRG

Seg: seg
186-212 seg

EMEEEEKEVAVGGGVKVGKEKVKEMVM

HMMPanther: PTHR23155
196-833 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VGGGVKVGKEKVKEMVMSGGGWEVVGICGMGGSGKTTLAMEIFKDQKVQAYFNNRVFFETVSQSANLETIKMKLWEQISSDIVLGQYNQIPEWQLRLGPRDRGPVLVILDDVWSLSQLEDLVFKFPGCKTLVVSRFKFPTIVTRTYEMKLLGEEEALSVFCRAAFDQESVPQTADKKLVRQVAAECRGLPLALKVIGASLRGQPPMIWLSAKNRLSRGESISDSHETKLLERMAASIECLSGKVRECFLDLGCFPEDKKIPLDVLINIWMEIHDLDEPDAFAILTELSNKNLLTLVNDAQNKAGDIYSSYHDYSVTQHDVLRDLALHMSGSDSLNKRRRLVMPRREESLPRDWQRNKDTPFEAQIVSIHTGEMKESDWFQMKFPKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTASAALDNLSAFTMLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELNDSLRGSTMDLSMTFPRLSNLTIDHCVDLKELPPTICEISSLERISISNCHDLTELPYELGKLHCLSILRVYACPALWKLPPSVCSLKRLKYLDVSQCINLTDLPEELGHLTNLEKIDMRECSRLRSLPRSSSSLKSLGHVVCDEETALLWREAEQVIPDLRVQVAEE

HMMPanther: PTHR23155:SF282
196-833 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VGGGVKVGKEKVKEMVMSGGGWEVVGICGMGGSGKTTLAMEIFKDQKVQAYFNNRVFFETVSQSANLETIKMKLWEQISSDIVLGQYNQIPEWQLRLGPRDRGPVLVILDDVWSLSQLEDLVFKFPGCKTLVVSRFKFPTIVTRTYEMKLLGEEEALSVFCRAAFDQESVPQTADKKLVRQVAAECRGLPLALKVIGASLRGQPPMIWLSAKNRLSRGESISDSHETKLLERMAASIECLSGKVRECFLDLGCFPEDKKIPLDVLINIWMEIHDLDEPDAFAILTELSNKNLLTLVNDAQNKAGDIYSSYHDYSVTQHDVLRDLALHMSGSDSLNKRRRLVMPRREESLPRDWQRNKDTPFEAQIVSIHTGEMKESDWFQMKFPKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTASAALDNLSAFTMLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELNDSLRGSTMDLSMTFPRLSNLTIDHCVDLKELPPTICEISSLERISISNCHDLTELPYELGKLHCLSILRVYACPALWKLPPSVCSLKRLKYLDVSQCINLTDLPEELGHLTNLEKIDMRECSRLRSLPRSSSSLKSLGHVVCDEETALLWREAEQVIPDLRVQVAEE

HMMPfam: PF00931
IPR002182
205-466 NB-ARC,NBS
NB-ARC

EKVKEMVMSGGGWEVVGICGMGGSGKTTLAMEIFKDQKVQAYFNNRVFFETVSQSANLETIKMKLWEQISSDIVLGQYNQIPEWQLRLGPRDRGPVLVILDDVWSLSQLEDLVFKFPGCKTLVVSRFKFPTIVTRTYEMKLLGEEEALSVFCRAAFDQESVPQTADKKLVRQVAAECRGLPLALKVIGASLRGQPPMIWLSAKNRLSRGESISDSHETKLLERMAASIECLSGKVRECFLDLGCFPEDKKIPLDVLINIWME

FPrintScan: PR00364
IPR000767
219-234 DISEASERSIST
Disease resistance protein

VVGICGMGGSGKTTLA

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

PRDRGPVLVILDDVW

FPrintScan: PR00364
IPR000767
381-395 DISEASERSIST
Disease resistance protein

CRGLPLALKVIGASL

superfamily: SSF52047
569-803 RNI-like,LRR

KESDWFQMKFPKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTASAALDNLSAFTMLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELNDSLRGSTMDLSMTFPRLSNLTIDHCVDLKELPPTICEISSLERISISNCHDLTELPYELGKLHCLSILRVYACPALWKLPPSVCSLKRLKYLDVSQCINLTDLPEELGHLTNLEKIDMRECSRLRSLPRSSSSLKSL

Gene3D: G3DSA:3.80.10.10
592-805 no description

VYYLPPFIATMQNLKALVLINYGTASAALDNLSAFTMLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELNDSLRGSTMDLSMTFPRLSNLTIDHCVDLKELPPTICEISSLERISISNCHDLTELPYELGKLHCLSILRVYACPALWKLPPSVCSLKRLKYLDVSQCINLTDLPEELGHLTNLEKIDMRECSRLRSLPRSSSSLKSLGH

Seg: seg
639-653 seg

KITLPPLPKTTIPLK

HMMPfam: PF00560
IPR001611
754-776 LRR_1
Leucine-rich repeat

RLKYLDVSQCINLTDLPEELGHL

FPrintScan: PR00364
IPR000767
774-790 DISEASERSIST
Disease resistance protein

GHLTNLEKIDMRECSRL

Seg: seg
788-803 seg

SRLRSLPRSSSSLKSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox