PRGDB00147219 (Bradi4g25570.1)

From PRG Wiki
Jump to: navigation, search
Bradi4g25570.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CN
Domain Type Ser-Thr Kinase, NBS
Gene Species Ricinus communis

Comment?

Clathrin, heavy chain (best arabidopsis hit); clathrin heavy chain, putative, expressed (best rice hit)

DNA Sequence

ATGGAGTCGGAGAAGTGCATCTGCGTCCGCGAGACCTCACCGCACAACAGAATCCTCATCATCGACATGGTCACGCGCATACCGCAGCCCCTCCGCCTGCCCATCGCCGCTGACTCCGCTCTCATCAACCCCGACACCAGTATCGTCGCGCTCAAAGCCCGATTACCTGGAACAGTACATGATCACCTGCAAATCTTCAATATTGAAGCTAAAACAAGAATGAAGAGGAAAAATATGTGTGAGGAGGTTGTGTTCTGGAAATGGATCACCCCAAAGTTGTTGGGATTGGTAACGCAAGTATCAGTTTATCACTGGTCTATTGAAGGAGATGCTGAACCCATCAAGATGTTTGATAGGACAGCTAATTTGGCCAACACTCGGATTATCAACTACCGTTGTGATCTGGCAGAGAAATGGCTTGTGCTTATTGGATTGGCATCTGATGTTCCAGAGAAGCCGCACTTGGTGAAGGGAGATGCACAACTTTTTTCTGTAGATCAGCAGTGTAGCCAGGCACTTAGAGCCCATGCAGCATGCTTTGCAACATTTAAGGTTCCTGGCAATGAGAACCTATCAACCTTCATCTGTTACGTCTCAAAGGCAACTAATGCTGGACATACTTTTGAGTTGCATGTTGTTGAATTGGGTGCACGGACAGAGGAACCTGGCTTTTCCAAGAAGCAAGTCGGTATCTTCTTCACACCACGTCTCCTGATTGATGCTTCTCTAGCCATGGAGTTCTCTCAGAAGTATGGCCTTATCTCTGTAATTACAAAGCTTGGCGTTTTGTTCATATATGACTTGGAAACTGCAACACAGGTTTATAGAGATAGAATCACTTCAGATCCTATATTGTTGACGGCAGAGTCTTCTACAACCGGTGGATTTTATGCCATCAACACGAGAGGACAAGTTTTACATGCCACAATTAATGATGCAACCATTGTGCCTTTTTGCATGCAGTTGAACAACTATAAGCTAGCCGCAAATCTCGCCAAAAGAGCTAATCTTCCTGTGGCAAAGGACTTGGTTGTGCAAATATTCCAGGAACTGTTCTCCCAAACAGAATACAAGGAAGCAGCAGAACTGGCTGTAGAATTCCCTCAGGGTCATCTACGTACTCCCGAGACCATTGCAAAATTCAAGATTGCTCCTCTTCAACTTGGGCAAGCATCTCCACTCCTGCAGTACTTCGACACATTGCTAACTAAATCGAAGCTCGATGCTTACGAGTCTCTTGAGTTATCTCGACTTGCTATTAATCAGAACGGGAGGAACCTTCTGGAGGGTTGGTTGGCAGATGAAAAGTTAGAGTGCAGTGAAGAGCTAGAAATCGCAGACCTAGCAAGTGAAATTGAAGCCCTTGAGCGCATATTGAGTGATGCAAGTGCACAGCCAACAAGGCTGTCTTATGCACTTCTAAGGTCTGTTACAAATAATTTCTCTAAAGTTATTGGGCATGGTGGATTTGCAGTAGTTTACCAGGGAGTTCTTCAAAACGGGAAGATTGCTGTTAAAAAGCTTTCCATATCAGATGGTTTTTCTGATGAGCTATTTGTGGACGAGATTGAGTGTTTAACAAAGGCAAAGCACAATAATGTAGTAAGGTATCTAGGCTATTGTGCAGATACACAAGGGGAATTGATGGAATTCAATGGAAGGTGTGTGATAGCAGAGGTACCAAAAAGGTTGCTCTGCTTTGAGTATGTCCCCAATGGAAGCCTTCACCGTTATCTTAAAGGAAAACCTTGTGGAGATGAATGGCAAGTACGTTATAAAATAATTAAGGGAATCTGTCAGGGTTTGCAGTATCTTCACAAAATCCGCATTAATCATTTGGATCTCAAGCCTGGTAATATTCTGTTGGATGTTGGCATGGAACCAAAAATTGCAGACTTTGGTTTGTCAAGATGCTTTGATGAAGAACAGTCCAGAGTTTTCACTAAACACGTTTATGGAACACCGGGATATATTGCACCAGAAATTATAAACAGTGGAGAAATATCATTCAAGTCAGATATATTCGCTTTCGGCATTATAATGATAAAGCTATTAACGGGGCACAACGACTATGATATTGAACGTTGGCATAAATCATTAAATAGGGACTGCCCACAAGTGAAAAGATGCATTGAAATAGCCCAAGCATGTGTGGACGATGACCAGCATAAAAGACCTGCCATAAGCGAGATAATTCATAAACTGGATGAGCTGGAGACCACTGTCGACTCTCCAGCTATCAATTAA


Protein sequences

Name Description Sequence
Bradi4g25570.1 Clathrin, heavy chain (best arabidopsis hit); clathrin heavy chain, putative, expressed (best rice hit)

MESEKCICVRETSPHNRILIIDMVTRIPQPLRLPIAADSALINPDTSIVALKARLPGTVHDHLQIFNIEAKTRMKRKNMCEEVVFWKWITPKLLGLVTQVSVYHWSIEGDAEPIKMFDRTANLANTRIINYRCDLAEKWLVLIGLASDVPEKPHLVKGDAQLFSVDQQCSQALRAHAACFATFKVPGNENLSTFICYVSKATNAGHTFELHVVELGARTEEPGFSKKQVGIFFTPRLLIDASLAMEFSQKYGLISVITKLGVLFIYDLETATQVYRDRITSDPILLTAESSTTGGFYAINTRGQVLHATINDATIVPFCMQLNNYKLAANLAKRANLPVAKDLVVQIFQELFSQTEYKEAAELAVEFPQGHLRTPETIAKFKIAPLQLGQASPLLQYFDTLLTKSKLDAYESLELSRLAINQNGRNLLEGWLADEKLECSEELEIADLASEIEALERILSDASAQPTRLSYALLRSVTNNFSKVIGHGGFAVVYQGVLQNGKIAVKKLSISDGFSDELFVDEIECLTKAKHNNVVRYLGYCADTQGELMEFNGRCVIAEVPKRLLCFEYVPNGSLHRYLKGKPCGDEWQVRYKIIKGICQGLQYLHKIRINHLDLKPGNILLDVGMEPKIADFGLSRCFDEEQSRVFTKHVYGTPGYIAPEIINSGEISFKSDIFAFGIIMIKLLTGHNDYDIERWHKSLNRDCPQVKRCIEIAQACVDDDQHKRPAISEIIHKLDELETTVDSPAIN*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10292
1-443 CLATHRIN HEAVY CHAIN,CLATHRIN HEAVY CHAIN

MESEKCICVRETSPHNRILIIDMVTRIPQPLRLPIAADSALINPDTSIVALKARLPGTVHDHLQIFNIEAKTRMKRKNMCEEVVFWKWITPKLLGLVTQVSVYHWSIEGDAEPIKMFDRTANLANTRIINYRCDLAEKWLVLIGLASDVPEKPHLVKGDAQLFSVDQQCSQALRAHAACFATFKVPGNENLSTFICYVSKATNAGHTFELHVVELGARTEEPGFSKKQVGIFFTPRLLIDASLAMEFSQKYGLISVITKLGVLFIYDLETATQVYRDRITSDPILLTAESSTTGGFYAINTRGQVLHATINDATIVPFCMQLNNYKLAANLAKRANLPVAKDLVVQIFQELFSQTEYKEAAELAVEFPQGHLRTPETIAKFKIAPLQLGQASPLLQYFDTLLTKSKLDAYESLELSRLAINQNGRNLLEGWLADEKLECSEEL

Gene3D: G3DSA:2.130.10.110
IPR016025
1-328 no description
Clathrin, heavy chain, linker/propeller domain

MESEKCICVRETSPHNRILIIDMVTRIPQPLRLPIAADSALINPDTSIVALKARLPGTVHDHLQIFNIEAKTRMKRKNMCEEVVFWKWITPKLLGLVTQVSVYHWSIEGDAEPIKMFDRTANLANTRIINYRCDLAEKWLVLIGLASDVPEKPHLVKGDAQLFSVDQQCSQALRAHAACFATFKVPGNENLSTFICYVSKATNAGHTFELHVVELGARTEEPGFSKKQVGIFFTPRLLIDASLAMEFSQKYGLISVITKLGVLFIYDLETATQVYRDRITSDPILLTAESSTTGGFYAINTRGQVLHATINDATIVPFCMQLNNYKLA

superfamily: SSF50989
IPR001473
1-311 Clathrin heavy-chain terminal domain
Clathrin, heavy chain, propeller, N-terminal

MESEKCICVRETSPHNRILIIDMVTRIPQPLRLPIAADSALINPDTSIVALKARLPGTVHDHLQIFNIEAKTRMKRKNMCEEVVFWKWITPKLLGLVTQVSVYHWSIEGDAEPIKMFDRTANLANTRIINYRCDLAEKWLVLIGLASDVPEKPHLVKGDAQLFSVDQQCSQALRAHAACFATFKVPGNENLSTFICYVSKATNAGHTFELHVVELGARTEEPGFSKKQVGIFFTPRLLIDASLAMEFSQKYGLISVITKLGVLFIYDLETATQVYRDRITSDPILLTAESSTTGGFYAINTRGQVLHATIN

superfamily: SSF48371
IPR016024
311-443 ARM repeat,NBS
Armadillo-type fold

NDATIVPFCMQLNNYKLAANLAKRANLPVAKDLVVQIFQELFSQTEYKEAAELAVEFPQGHLRTPETIAKFKIAPLQLGQASPLLQYFDTLLTKSKLDAYESLELSRLAINQNGRNLLEGWLADEKLECSEEL

Seg: seg
322-337 seg

LNNYKLAANLAKRANL

Gene3D: G3DSA:1.25.40.30
IPR012331
329-443 no description
Clathrin, heavy chain, linker

ANLAKRANLPVAKDLVVQIFQELFSQTEYKEAAELAVEFPQGHLRTPETIAKFKIAPLQLGQASPLLQYFDTLLTKSKLDAYESLELSRLAINQNGRNLLEGWLADEKLECSEEL

HMMPfam: PF13838
336-401 Clathrin_H_link,Clathrin-H-link

NLPVAKDLVVQIFQELFSQTEYKEAAELAVEFPQGHLRTPETIAKFKIAPLQLGQASPLLQYFDTL

Coil: coil
445-466 coiled-coil

IADLASEIEALERILSDASAQP

superfamily: SSF56112
IPR011009
453-735 Protein kinase-like (PK-like)
Protein kinase-like domain

EALERILSDASAQPTRLSYALLRSVTNNFSKVIGHGGFAVVYQGVLQNGKIAVKKLSISDGFSDELFVDEIECLTKAKHNNVVRYLGYCADTQGELMEFNGRCVIAEVPKRLLCFEYVPNGSLHRYLKGKPCGDEWQVRYKIIKGICQGLQYLHKIRINHLDLKPGNILLDVGMEPKIADFGLSRCFDEEQSRVFTKHVYGTPGYIAPEIINSGEISFKSDIFAFGIIMIKLLTGHNDYDIERWHKSLNRDCPQVKRCIEIAQACVDDDQHKRPAISEIIHKL

Gene3D: G3DSA:3.30.200.20
465-535 no description

QPTRLSYALLRSVTNNFSKVIGHGGFAVVYQGVLQNGKIAVKKLSISDGFSDELFVDEIECLTKAKHNNVV

HMMSmart: SM00220
IPR002290
479-739 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NNFSKVIGHGGFAVVYQGVLQNGKIAVKKLSISDGFSDELFVDEIECLTKAKHNNVVRYLGYCADTQGELMEFNGRCVIAEVPKRLLCFEYVPNGSLHRYLKGKPCGDEWQVRYKIIKGICQGLQYLHKIRINHLDLKPGNILLDVGMEPKIADFGLSRCFDEEQSRVFTKHVYGTPGYIAPEIINSGEISFKSDIFAFGIIMIKLLTGHNDYDIERWHKSLNRDCPQVKRCIEIAQACVDDDQHKRPAISEIIHKLDELE

ProfileScan: PS50011
IPR000719
479-747 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NNFSKVIGHGGFAVVYQGVLQNGKIAVKKLSISDGFSDELFVDEIECLTKAKHNNVVRYLGYCADTQGELMEFNGRCVIAEVPKRLLCFEYVPNGSLHRYLKGKPCGDEWQVRYKIIKGICQGLQYLHKIRINHLDLKPGNILLDVGMEPKIADFGLSRCFDEEQSRVFTKHVYGTPGYIAPEIINSGEISFKSDIFAFGIIMIKLLTGHNDYDIERWHKSLNRDCPQVKRCIEIAQACVDDDQHKRPAISEIIHKLDELETTVDSPAI

HMMSmart: SM00219
IPR020635
479-735 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

NNFSKVIGHGGFAVVYQGVLQNGKIAVKKLSISDGFSDELFVDEIECLTKAKHNNVVRYLGYCADTQGELMEFNGRCVIAEVPKRLLCFEYVPNGSLHRYLKGKPCGDEWQVRYKIIKGICQGLQYLHKIRINHLDLKPGNILLDVGMEPKIADFGLSRCFDEEQSRVFTKHVYGTPGYIAPEIINSGEISFKSDIFAFGIIMIKLLTGHNDYDIERWHKSLNRDCPQVKRCIEIAQACVDDDQHKRPAISEIIHKL

HMMPfam: PF00069
IPR000719
482-733 Pkinase,Ser-thr
Protein kinase, catalytic domain

SKVIGHGGFAVVYQGVLQNGKIAVKKLSISDGFSDELFVDEIECLTKAKHNNVVRYLGYCADTQGELMEFNGRCVIAEVPKRLLCFEYVPNGSLHRYLKGKPCGDEWQVRYKIIKGICQGLQYLHKIRINHLDLKPGNILLDVGMEPKIADFGLSRCFDEEQSRVFTKHVYGTPGYIAPEIINSGEISFKSDIFAFGIIMIKLLTGHNDYDIERWHKSLNRDCPQVKRCIEIAQACVDDDQHKRPAISEIIH

PatternScan: PS00107
IPR017441
485-507 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGGFAVVYQGVLQNGKIAVKK

Gene3D: G3DSA:1.10.510.10
536-734 no description

RYLGYCADTQGELMEFNGRCVIAEVPKRLLCFEYVPNGSLHRYLKGKPCGDEWQVRYKIIKGICQGLQYLHKIRINHLDLKPGNILLDVGMEPKIADFGLSRCFDEEQSRVFTKHVYGTPGYIAPEIINSGEISFKSDIFAFGIIMIKLLTGHNDYDIERWHKSLNRDCPQVKRCIEIAQACVDDDQHKRPAISEIIHK

PatternScan: PS00108
IPR008271
610-622 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

INHLDLKPGNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox