PRGDB00147280 (Bradi4g38690.1)

From PRG Wiki
Jump to: navigation, search
Bradi4g38690.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CN
Domain Type NBS, Ser-Thr Kinase
Gene Species Ricinus communis

Comment?

U-box domain-containing protein kinase family protein (best arabidopsis hit); protein kinase family protein, putative, expressed (best rice hit)

DNA Sequence

ATGTTCATGCGTGGAGGGAGCGGGCGGTCATCCAACGGTAGCGGTACTAACAGGAGCGCCAGCCTCAGAGAGATCGATGAGGAGGCTGCGACCATCTCTGAGCCAGAGGAGGACAACGATAGCGGAGGGAAGCTGCACGTGGCTGTCGGGAAGGACCTCAAGGACAGCAGGTCCAGCCTCATCTGGGCAGCCGGGAACCTCCTGCACGGTGGTGATCTCAGGCTTGTCCTGCTGCATGTCCATCAGCCTGCCGAGAGGATTATGAACGGATTATGCAAGGTCCCTGCAAGCCATCTGGAAGAAAAGGAGCTCAGAGCATACAGAAGGATCGAGAAGGACGATATGGATGCACTTTTAAATCAGTACCTTAATTTCTGCAGAATATCTCTAAAGGTGCAAGCCGAAACACTAGTGATCGAGAAGAACACTCCTGCACATGGCATTATAGAGCTCATTGATAAGTATCACATTACAAAGCTTGTTATGGGAACATCTTCCGTCTCAGTGAAGAGGAACATACCAAAATCAAAAGTTGCAGCCAGTGTTCACCTACAGGCCAAACCATATTGCCAGATCTTCTATGTTTCCAAAGAGACTCTTGCTTGCTCTAGGGAAGCCACTCAGCTCTCTGTGAAACCAGAGTCACCCAGAAGCAGCTGCGCGAGCTCTCTCTCAGATCAATCTGAGTTCCCTGCAAGATCAGCGTCATTGCCACCAGGTCATCCAGGTTTCTTAGGCTCTGCAGATCAAGAAGCCCTTCCTCGACGCTCCAACTCAGTTAGTTATCCCTTGTCAGGATCAATAGTGGACAGTGTGGAAAACCTGTCACTTGCAAGGCGGCAATCGATTGATATGACATCAACAGTTTTCTCACCAAATTCCAGCCAACAAAGCACTGTAGGATCCTCATTAGATCTGAAGGATTTGGACAGTATGGATGGATCGCCAACACCTGTTTCAATAGCAATCTCTGAACATCAGCATTCCATGGTGGAAACAGTCATACAAAATGAAGTGTTTGAGCAACTGCACCGAGTCCGCAATGAGCTAGAGCGCTCAAGAAAGGAAGCATCTGAGGGACGGCAGAAAGCCGAGAAGGATCTGTATGAAGCCTCGATGAAGTTCAGAGCACGGGAGAATTCACTCTGCAGAGAAAAGAAGGAGGTGGAGGAAAGACTGACCAGAGAAAAGGCTGGCCTCGAAAAAGAGCACCTCAATATATGCAACGAGCTGCAGAAGGCAAATGGGAAAAGGGCAGAGCTGGAGAACAAGCTTCTTCAGGCCAATTGCAGAATAGAAGAGCTCCAACAGCTGCAAGGAGAGCTGCAGTGCGAGAAAGACCATGCTGTGAGAGAAGCTGAAGAGATGCGCCAAATAAATGGTAACATTGTATTTGGCTCCACTGGTGCAGTTGCCTTGACAGAGTTCAGCTACACAGAGATAAAAGAAGCAACCAGTGACTTTGATGACTCCAAAAAGATTGGGCATGGTGGATGTGGAAGCGTCTACAAGGGCTTTCTCCGTCATACTACTGTGGCTATAAAGAAATTCAACCGTGAAGGCACAACAGGAGAGAAAGAGTTCAATGACGAGGTAGAAACACTTTCTAGGATGAGGCATCCGAACCTTGTCACTCTGATAGGAGTTTGCAGGGAGGCCAAAGCATTAGTTTTCGAATTCATGTCAAACGGAAGCCTAGAGGACTGTTTGCAGTGCAAGAACCAAACACATCCACTCTCGTGGAAAATGCGCATCAGAATTGCTGCCGACATCTGCATAGGACTTATTTTCCTCCACTCCAACAAACCAAAAGGCATTGCCCATGGTGATCTGAAGCCTGACAATGTCCTTCTCGACGCTAGCTTTGTTTGCAAACTGGCAGACTTCGGGATCTCTCGTCCCCTGAATCTGACAAACACCACTGTCACCCCATACCACCGAACAAACCAAATTAAAGGCACAATGGGATACATGGATCCAGGATACATTGCTTCAGGGGAGCTCACAGCGCAATATGATGTTTACTCTTTTGGAGTAGTTCTGATGCGATTGCTAACTGGCAAGAACCCCCTCGGCCTTCCGAACGAGGTGGAGGCAGCCTTGAGCAATGGACTGTTGCAAGATATAATGGATGCCTCTGCAGGGGATTGGCCACCTGAGTACACTGAAGAATTGGCAAGACTGGCACTGCGATGTTGCCGGTATGACAGAAAGAAGCGCCCTGATCTTGCAAACGAGGCCTGGGGTGTTCTGCAAGCTATGATTAACTATCCAGATGACAAATCCGCGACACCATCATTTTTCATCTGTCCAATGACACAGGAGATCATGAGGGATCCACACATTGCAGCTGATGGATTCACATATGAAGGTGAGGCTATAAAGGACTGGCTTCAAAGGGGGCATAAAATGTCCCCCACGATCTACCTCGACCTCGCACACCATGAGTTAATACCGAACAATGCCCTTCGTTTCGCAATTCAAGAATGGCAAATGCAACAGAAACCGTGA


Protein sequences

Name Description Sequence
Bradi4g38690.1 U-box domain-containing protein kinase family protein (best arabidopsis hit); protein kinase family protein, putative, expressed (best rice hit)

MFMRGGSGRSSNGSGTNRSASLREIDEEAATISEPEEDNDSGGKLHVAVGKDLKDSRSSLIWAAGNLLHGGDLRLVLLHVHQPAERIMNGLCKVPASHLEEKELRAYRRIEKDDMDALLNQYLNFCRISLKVQAETLVIEKNTPAHGIIELIDKYHITKLVMGTSSVSVKRNIPKSKVAASVHLQAKPYCQIFYVSKETLACSREATQLSVKPESPRSSCASSLSDQSEFPARSASLPPGHPGFLGSADQEALPRRSNSVSYPLSGSIVDSVENLSLARRQSIDMTSTVFSPNSSQQSTVGSSLDLKDLDSMDGSPTPVSIAISEHQHSMVETVIQNEVFEQLHRVRNELERSRKEASEGRQKAEKDLYEASMKFRARENSLCREKKEVEERLTREKAGLEKEHLNICNELQKANGKRAELENKLLQANCRIEELQQLQGELQCEKDHAVREAEEMRQINGNIVFGSTGAVALTEFSYTEIKEATSDFDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDLANEAWGVLQAMINYPDDKSATPSFFICPMTQEIMRDPHIAADGFTYEGEAIKDWLQRGHKMSPTIYLDLAHHELIPNNALRFAIQEWQMQQKP*

Domains

Domain Start-End Description Sequence

Seg: seg
4-19 seg

RGGSGRSSNGSGTNRS

superfamily: SSF52402
46-195 Adenine nucleotide alpha hydrolases-like

HVAVGKDLKDSRSSLIWAAGNLLHGGDLRLVLLHVHQPAERIMNGLCKVPASHLEEKELRAYRRIEKDDMDALLNQYLNFCRISLKVQAETLVIEKNTPAHGIIELIDKYHITKLVMGTSSVSVKRNIPKSKVAASVHLQAKPYCQIFYV

HMMPfam: PF00582
IPR006016
53-168 Usp
UspA

LKDSRSSLIWAAGNLLHGGDLRLVLLHVHQPAERIMNGLCKVPASHLEEKELRAYRRIEKDDMDALLNQYLNFCRISLKVQAETLVIEKNTPAHGIIELIDKYHITKLVMGTSSVS

Gene3D: G3DSA:3.40.50.620
IPR014729
54-168 no description
Rossmann-like alpha/beta/alpha sandwich fold

KDSRSSLIWAAGNLLHGGDLRLVLLHVHQPAERIMNGLCKVPASHLEEKELRAYRRIEKDDMDALLNQYLNFCRISLKVQAETLVIEKNTPAHGIIELIDKYHITKLVMGTSSVS

Seg: seg
67-81 seg

LLHGGDLRLVLLHVH

HMMPanther: PTHR24420:SF448
190-810 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CQIFYVSKETLACSREATQLSVKPESPRSSCASSLSDQSEFPARSASLPPGHPGFLGSADQEALPRRSNSVSYPLSGSIVDSVENLSLARRQSIDMTSTVFSPNSSQQSTVGSSLDLKDLDSMDGSPTPVSIAISEHQHSMVETVIQNEVFEQLHRVRNELERSRKEASEGRQKAEKDLYEASMKFRARENSLCREKKEVEERLTREKAGLEKEHLNICNELQKANGKRAELENKLLQANCRIEELQQLQGELQCEKDHAVREAEEMRQINGNIVFGSTGAVALTEFSYTEIKEATSDFDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDLANEAWGVLQAMINYPDDKSATPSFFICPMTQEIMRDPHIAADGFTYEGEAIKDWLQRGHKMSPTIYL

HMMPanther: PTHR24420
190-810 FAMILY NOT NAMED,FAMILY NOT NAMED

CQIFYVSKETLACSREATQLSVKPESPRSSCASSLSDQSEFPARSASLPPGHPGFLGSADQEALPRRSNSVSYPLSGSIVDSVENLSLARRQSIDMTSTVFSPNSSQQSTVGSSLDLKDLDSMDGSPTPVSIAISEHQHSMVETVIQNEVFEQLHRVRNELERSRKEASEGRQKAEKDLYEASMKFRARENSLCREKKEVEERLTREKAGLEKEHLNICNELQKANGKRAELENKLLQANCRIEELQQLQGELQCEKDHAVREAEEMRQINGNIVFGSTGAVALTEFSYTEIKEATSDFDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDLANEAWGVLQAMINYPDDKSATPSFFICPMTQEIMRDPHIAADGFTYEGEAIKDWLQRGHKMSPTIYL

Seg: seg
302-311 seg

SSLDLKDLDS

Coil: coil
336-368 coiled-coil

QNEVFEQLHRVRNELERSRKEASEGRQKAEKDL

Coil: coil
383-453 coiled-coil

CREKKEVEERLTREKAGLEKEHLNICNELQKANGKRAELENKLLQANCRIEELQQLQGELQCEKDHAVREA

Seg: seg
433-445 seg

EELQQLQGELQCE

superfamily: SSF56112
IPR011009
460-773 Protein kinase-like (PK-like)
Protein kinase-like domain

NGNIVFGSTGAVALTEFSYTEIKEATSDFDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDLANEAWGVLQAMINYPDDKSATPSFFICPMT

Gene3D: G3DSA:3.30.200.20
473-547 no description

LTEFSYTEIKEATSDFDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLI

HMMSmart: SM00219
IPR020635
488-750 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDLANEAWGV

HMMSmart: SM00220
IPR002290
488-755 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDLANEAWGVLQAMI

ProfileScan: PS50011
IPR000719
488-755 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDDSKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDLANEAWGVLQAMI

HMMPfam: PF00069
IPR000719
491-743 Pkinase,Ser-thr
Protein kinase, catalytic domain

SKKIGHGGCGSVYKGFLRHTTVAIKKFNREGTTGEKEFNDEVETLSRMRHPNLVTLIGVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDL

Gene3D: G3DSA:1.10.510.10
548-747 no description

GVCREAKALVFEFMSNGSLEDCLQCKNQTHPLSWKMRIRIAADICIGLIFLHSNKPKGIAHGDLKPDNVLLDASFVCKLADFGISRPLNLTNTTVTPYHRTNQIKGTMGYMDPGYIASGELTAQYDVYSFGVVLMRLLTGKNPLGLPNEVEAALSNGLLQDIMDASAGDWPPEYTEELARLALRCCRYDRKKRPDLANEA

PatternScan: PS00108
IPR008271
606-618 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IAHGDLKPDNVLL

superfamily: SSF57850
763-835 RING/U-box,NBS

ATPSFFICPMTQEIMRDPHIAADGFTYEGEAIKDWLQRGHKMSPTIYLDLAHHELIPNNALRFAIQEWQMQQK

Gene3D: G3DSA:3.30.40.10
IPR013083
764-834 no description
Zinc finger, RING/FYVE/PHD-type

TPSFFICPMTQEIMRDPHIAADGFTYEGEAIKDWLQRGHKMSPTIYLDLAHHELIPNNALRFAIQEWQMQQ

HMMPfam: PF04564
IPR003613
765-835 U-box
U box domain

PSFFICPMTQEIMRDPHIAADGFTYEGEAIKDWLQRGHKMSPTIYLDLAHHELIPNNALRFAIQEWQMQQK

HMMSmart: SM00504
IPR003613
767-830 Modified RING finger domain
U box domain

FFICPMTQEIMRDPHIAADGFTYEGEAIKDWLQRGHKMSPTIYLDLAHHELIPNNALRFAIQEW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox