PRGDB00150839 (Cre13.g589500.t1.2)

From PRG Wiki
Jump to: navigation, search
Cre13.g589500.t1.2
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Chlamydomonas reinhardtii

Comment?

ACT-like protein tyrosine kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGCGGGGCACAACTGTGACCAGCTGAGGCTGAGTCTTAGTGGCCTCACCGCCCTAGCTTTCCTGGCTTTCTGTGCCGTCAAAGTGGAGGCATGGGGCTACCATGGAGCACGAAGCTTGCCTGGGCTCGGCCGGCGTGTTGTCGCAGGGACAAGTTTTGACCTGCTCTCAGCGCTTGAGGACCCGAGCATTGACAGGATAGTATTAACGGGTGATCTCGTTCTCGACAAGCGCGTCTTCAGCTCGGACAGCGAGCAACACGTCTTTCCGCTACACATTCGGCGCAATGTGACTATCAAAAGTATCCTGACTAGCGAAGCGTTCGCGAGTCTGGACTTTCGGTACCTGTCAGGCAAACTCCACTTAGCGCCGGGGGTTTGGCTGACGATCTACCGGCTGCGTGTGCGCGGCCTGACGGCCTCCTGTGCGCCCACCTTCCCCTTCGTCACCGTGTCACAAGGAGCGGGCGTGGTATTTCGTGACTGTGTGCTTCATCGCTTGGCGTGTCTGCCCATGGACATGGTTTACGAGAGCATCATTCACGGTGGCGAAGTGAGCCATGGTGACGGAAGCGGCCAGAAGCTGCGGGAAGGTGCCGGAAAGCTGGCTCCGCCGCCGCCGCCAGGGCACTCGGCGGCGGCAGGGAGAGCGGGAGGTGGCGGCGGCGGCAGCAGGGTGAAGGGCAGTGGCGAGGACAGTGCGGGGGAAGAGCGTGGCACGGCGGCCGTGACGTTGGGTCCGACAGAGGTGGAGTTGGTGCAGCGCTACTGCTTCAGTGCGGTGCAGGGTGGGCGCTACTGCCGCCCACAGGCGCTGCAGCTGCACCGCTACGTCTACGCCACGCCCGTGCCCACGGCGCTGCTACAGCCGCCGCAGTCTGGCGCCGCCGCGGTGGCGCCGACCGGCGCGGCGGCTGTAGCAGGCGCGGATGGCGCGGCGGTAGTAGCCGATCCAGTTCCTGTAGGCACGGCTGGTCCGGGCGGGGCCGCAGCTACAGCCGCGGCAGCTGCAGCCGCGGCAGCTACTGCCGCGGCGTTCACGCTTGTGGCCGAGGACACGGTAATGGTGTGTGATCACCCCGTGAGCGCAGCGTGTGTGCGCGACAATGGCCCCGAGTTCTGCGTTAAGCGGGAAATCGCGGCTCGCCTGGCGGCGGAGGAGCGACAGAGCTCCAGCCTGGCGGCAGCCGTTGGCGCAACCGTCGCGGTTACGGCGATGGCGGTTGGCTGGTGGGTGCTGGCGGCGCGGCGGCGCAGCAGGAAGGCCGCGGCGGCGGCGGCGGAGGAAGAGGCGGCAGCCGCCCAGGAGCAGCAACGGTTGTGGGCGCATTCGGCGGCTGTGGCAGCTGGGGAGTCTGGCGGGACCGAGGTGCAGCAGGCTCTGGAGGTGTTGCTGCGGCAGCTGGCGGTGGCGGGTGACAGCGCGGCGCCGTCGGCGTCGGCCGCGCCGTCCACCAGCGGCGATGGGCGCTTCGTGCGCATGTCCGGCAGCTCAAACTCCCGCACGACCTCGCGCAACCCCTCCCGCACCGTGTCGCGGACCTCCACGCGCAACCCCCTCGACGCCGGTGCTGGCGGCGGCGCCGCCGCCGCCGCAAGCGGTCTCGCCGGCCCTACCAGCAGCTCCGTCTTTTCGGCCGTAAGCCAGACGACCAGCGCCAACCAACATGCCGCACTGGCGCTGGCGCTGGCGCCGGCGAACAACAGCAACAGCAGGAGCAGCGCTGCCCTCGGCACCGGCGGCGGAAGCGGCGCGCCGCCATCAGCGGTGTCGGTCGCCGCGGCGGCGCTGGCTGCGGCGGTCGCGAACGCGAACGCAAATGCTAACACCGGCTCGGGCGCGGGCACAGGCGCGGCCGCACAGGTTGTTAAGCGGTCTTCCGGACGGACAGGAGCGACGCAGTCCGTCCCTACCAGCGGCGCAACATCCGGGACGGGTGTCGGCGGCGCCGCCGCCACAGTGCCGTACGCACCGCACGACAGCGTTGCGCCGATTGACCCTGCCATGCTACTGGCAGCGGACCGGCTGGGACGGCGGATGCATGCCCAGGGCGGCAAGGGCGAGGTGGCCTCTCCCAACGCAAACACACAAGGCATGAGCGCGAACTCACACACGACGGCCACGCCGGCGACGGCCACCAGCGCCGATGCGGATGAGCTGGCGGCGCTGGTAGGGGCGACGGCACGCTCTAGTGCCGGCGGTCTGCTGAAGCCGGCTGCAATCGAGACGCAGGAGCGTATCGAGTCCCTGCGGCGCAGCATGCGCTCCGAGGGGCCCGCCATCCCTCTCAGCCCGGTCGGTGTCGGCGGCGGCGGCAGCAGCAGCTGGTACGGCAGTAGCGGCGGTACCGATGACTTGGAGATTACAGATCTGCTGGGGGCGGGCACGTTTGGCAAGGTGTTCAAGGGGTTTTGGCACGGCACGCTCGTGGCGGTTAAGCACATGGTCTTCCCACGTGGCGTGCTGCTGGCGGGCGCGGCGGTTGGCGGCACCGGCGGCGGTGGAGGGCTCGGCGGCAAGCCGGGCGCAGGTGGCGGCGCGGCGGGCGCGGTGCAGCTGCAGCTTGAGCGCATGGCTGCAATGGAGGCAGCCATTAGCACGAGCCTGTCCCACCCCAACGTCGTCCAGACCTATACCTGGCGAGTCACGCCGCTCGGGGACGCCGCGCAGCCCCACGATGCGCGCCACCACCCGGCATCAGCGCCCCGTCCCGGCCTTGGCGTCGGCCCAGGCGCCGGCCAGGGCCCCGCCCTGCGGCGCAGCACCGTCAGCGGCGTGGGCTCGGCCGGCACCGCCAGTGTGGAGGCCCAGACCCAGGAGGCCCTGCCACCGCTGGCGCTGGCTGGGCAGCGGCAGCAGCGCGCCTCTGACACGGGGCCGCAACAGGGCCCCGGGTCGCCCTTGGCGTGGCGGTCGCTTCCCGGCGGCGGCGGCGTCGCGGGCGAGGCCGGGGCACGTGGGCCGCCGCTGCCGCCGCGGCACCACTCCGGCGAGGGACAGCAGCAAGGGGGTCAGGGGGCGCAGTGGGGGGCCGTGGCGAGCCAGCAGCAGCAGCAGCAGCAGCAGCAGGAGGGGCACGCGGAGCCGTGCCTTCACTCCAACGCAGCGGCATTGGAGAAGGGCTTTGAGCTGTGCCTCATTCTGGAGCTGTGTGACATGGGCTCTCTGCGCGACCACCTGGCCCGCGGCGGCTTCCGCTGCACACACGACCACGGCTCTGTGGACCACGGCGCAGTGCTGGACCTGGCCATGGACGTGGCTCGCGCGATGTCTTACCTGCACTCCAAGAACATTGTGCACTCCGACCTCAAGAGTCGCAACGTGCTGCTCAAGTCGCTGAGCGGCCCGCCCGGCTCTCACGGCCGCTGCTGCCCGCTGGTGGCCAAGGTGTCGGACTTCGGGCTTGCGTTCAAGATGGAGGGCGAGGAGACGCACGTATCGGGCATGTACCAGGGCACGCTGGCCTGGAGCGCGCCGGAGCTCCTGATGGAGGGCCGCGTGTCCAAAGCCGCTGACGTGTACAGCTTCGGCGTCCTGCTGTGGGAGATGTACACGTGTGGCGAGGCATTCAAGGGCATCCCACGACCGCTGCTGGCGGGCAAGGTGGTGGAGGGGCTGCGGCCCGACTTCCCGCCCGAGACCCCGCCCGAGTACATGCGGCTGGCGGCGGCGTGCTGGGGCCACGACCCGGCGCAGCGGCCCTCCTTTGATCAGGTGGTCAGGGAGCTGGCCTGCATGCGGGCGGCATGGGCGGGCGGGCGGCCGCCTACGGGTCAGCTGGGCTCCGTGAGCGCCCAGGTGCAGCGACGTGATTCCTTGGCCCGCGTTAGCGCCAGCCGCGTGACCTCGGCTAGGGGTACGGCGGGCGGGCCGCCGCCGCCCACTCACGCCCTGCAGCTGCTCCAAGTCGCCAACCTCAGCAGCGGGGGCAACAACAAGAGGAGCAGCGGCCGCGACGGCGGGGCCGAAGCCAATGGCGGCGGCGGCGCGAGTCCGGGACCGTGGGCCGAGCAGCCGCGGGCAAACCATCTGCTGGACGAAGGCAACAGCCACGATGGGCACGATGGTACTAGCAGAGAGGTGCCGGGGCAGGAATGGATTGGAGCGGGGGACGGCGACGGCGCTGGCGAGAGTGAGGACAGCCGGCGACGGCCGCTGCCGCTGCCGCTGCTCACCACAGCCCTTGGCAGCACCGGCACGGGCGTGGGCGACGGCTCGGGGGTGGCCAGGCCGCTTAAGCAGCAGCTGCTATCGCCGCCTGGCGGCGCAGCGGCGGTGGCTGCGCTGCGCCTCAAGGGCGCCTCGGTACGCCGCCGCACGCGGCAGGGACACCAGTCTGCCGCTGGGGAAGGCGTGCGCATGCTGTCAGCCAAGGATGCGTCGGCTAACTCGGATGCCGGCGGCAGCTACACGGGTAGTGGGGGACCGGACGGCAGCGAGGGCGGCCCACGCGCGCTTCTGGGCGTTGGTCTGGACACCGCTGACCTCATCGACAAGGAGCTGTTGGTGGTGGGCGGCGGCGGCGGCACGGGCACGGGCACCTTTGACGACAGCAGCATGTGGGGGCTGTAG


Protein sequences

Name Description Sequence
Cre13.g589500.t1.2 ACT-like protein tyrosine kinase family protein (best arabidopsis hit)

MAGHNCDQLRLSLSGLTALAFLAFCAVKVEAWGYHGARSLPGLGRRVVAGTSFDLLSALEDPSIDRIVLTGDLVLDKRVFSSDSEQHVFPLHIRRNVTIKSILTSEAFASLDFRYLSGKLHLAPGVWLTIYRLRVRGLTASCAPTFPFVTVSQGAGVVFRDCVLHRLACLPMDMVYESIIHGGEVSHGDGSGQKLREGAGKLAPPPPPGHSAAAGRAGGGGGGSRVKGSGEDSAGEERGTAAVTLGPTEVELVQRYCFSAVQGGRYCRPQALQLHRYVYATPVPTALLQPPQSGAAAVAPTGAAAVAGADGAAVVADPVPVGTAGPGGAAATAAAAAAAAATAAAFTLVAEDTVMVCDHPVSAACVRDNGPEFCVKREIAARLAAEERQSSSLAAAVGATVAVTAMAVGWWVLAARRRSRKAAAAAAEEEAAAAQEQQRLWAHSAAVAAGESGGTEVQQALEVLLRQLAVAGDSAAPSASAAPSTSGDGRFVRMSGSSNSRTTSRNPSRTVSRTSTRNPLDAGAGGGAAAAASGLAGPTSSSVFSAVSQTTSANQHAALALALAPANNSNSRSSAALGTGGGSGAPPSAVSVAAAALAAAVANANANANTGSGAGTGAAAQVVKRSSGRTGATQSVPTSGATSGTGVGGAAATVPYAPHDSVAPIDPAMLLAADRLGRRMHAQGGKGEVASPNANTQGMSANSHTTATPATATSADADELAALVGATARSSAGGLLKPAAIETQERIESLRRSMRSEGPAIPLSPVGVGGGGSSSWYGSSGGTDDLEITDLLGAGTFGKVFKGFWHGTLVAVKHMVFPRGVLLAGAAVGGTGGGGGLGGKPGAGGGAAGAVQLQLERMAAMEAAISTSLSHPNVVQTYTWRVTPLGDAAQPHDARHHPASAPRPGLGVGPGAGQGPALRRSTVSGVGSAGTASVEAQTQEALPPLALAGQRQQRASDTGPQQGPGSPLAWRSLPGGGGVAGEAGARGPPLPPRHHSGEGQQQGGQGAQWGAVASQQQQQQQQQEGHAEPCLHSNAAALEKGFELCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVRELACMRAAWAGGRPPTGQLGSVSAQVQRRDSLARVSASRVTSARGTAGGPPPPTHALQLLQVANLSSGGNNKRSSGRDGGAEANGGGGASPGPWAEQPRANHLLDEGNSHDGHDGTSREVPGQEWIGAGDGDGAGESEDSRRRPLPLPLLTTALGSTGTGVGDGSGVARPLKQQLLSPPGGAAAVAALRLKGASVRRRTRQGHQSAAGEGVRMLSAKDASANSDAGGSYTGSGGPDGSEGGPRALLGVGLDTADLIDKELLVVGGGGGTGTGTFDDSSMWGL*

Domains

Domain Start-End Description Sequence

Seg: seg
198-230 seg

GAGKLAPPPPPGHSAAAGRAGGGGGGSRVKGSG

Seg: seg
294-345 seg

GAAAVAPTGAAAVAGADGAAVVADPVPVGTAGPGGAAATAAAAAAAAATAAA

Seg: seg
377-388 seg

REIAARLAAEER

Seg: seg
394-412 seg

AAAVGATVAVTAMAVGWWV

Seg: seg
414-439 seg

AARRRSRKAAAAAAEEEAAAAQEQQR

Coil: coil
417-438 coiled-coil

RRSRKAAAAAAEEEAAAAQEQQ

Seg: seg
474-486 seg

SAAPSASAAPSTS

Seg: seg
495-518 seg

SGSSNSRTTSRNPSRTVSRTSTRN

Seg: seg
522-537 seg

AGAGGGAAAAASGLAG

Seg: seg
552-620 seg

SANQHAALALALAPANNSNSRSSAALGTGGGSGAPPSAVSVAAAALAAAVANANANANTGSGAGTGAAA

Seg: seg
635-658 seg

SVPTSGATSGTGVGGAAATVPYAP

Seg: seg
700-717 seg

SANSHTTATPATATSADA

Seg: seg
764-782 seg

SPVGVGGGGSSSWYGSSGG

superfamily: SSF56112
IPR011009
768-1305 Protein kinase-like (PK-like)
Protein kinase-like domain

VGGGGSSSWYGSSGGTDDLEITDLLGAGTFGKVFKGFWHGTLVAVKHMVFPRGVLLAGAAVGGTGGGGGLGGKPGAGGGAAGAVQLQLERMAAMEAAISTSLSHPNVVQTYTWRVTPLGDAAQPHDARHHPASAPRPGLGVGPGAGQGPALRRSTVSGVGSAGTASVEAQTQEALPPLALAGQRQQRASDTGPQQGPGSPLAWRSLPGGGGVAGEAGARGPPLPPRHHSGEGQQQGGQGAQWGAVASQQQQQQQQQEGHAEPCLHSNAAALEKGFELCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVRELACMRAAWAGGRPPTGQLGSVSAQVQRRDSLARVSASRVTSARGTAGGPPPPTHALQLLQVAN

HMMPanther: PTHR23257
784-1445 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

DDLEITDLLGAGTFGKVFKGFWHGTLVAVKHMVFPRGVLLAGAAVGGTGGGGGLGGKPGAGGGAAGAVQLQLERMAAMEAAISTSLSHPNVVQTYTWRVTPLGDAAQPHDARHHPASAPRPGLGVGPGAGQGPALRRSTVSGVGSAGTASVEAQTQEALPPLALAGQRQQRASDTGPQQGPGSPLAWRSLPGGGGVAGEAGARGPPLPPRHHSGEGQQQGGQGAQWGAVASQQQQQQQQQEGHAEPCLHSNAAALEKGFELCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVRELACMRAAWAGGRPPTGQLGSVSAQVQRRDSLARVSASRVTSARGTAGGPPPPTHALQLLQVANLSSGGNNKRSSGRDGGAEANGGGGASPGPWAEQPRANHLLDEGNSHDGHDGTSREVPGQEWIGAGDGDGAGESEDSRRRPLPLPLLTTALGSTGTGVGDGSGVARPLKQQLLSPPGGAAAVAALRLKGASVRRRTRQGHQ

HMMPanther: PTHR23257:SF99
784-1445 TGF-BETA-ACTIVATED KINASE 1,TGF-BETA-ACTIVATED KINASE 1

DDLEITDLLGAGTFGKVFKGFWHGTLVAVKHMVFPRGVLLAGAAVGGTGGGGGLGGKPGAGGGAAGAVQLQLERMAAMEAAISTSLSHPNVVQTYTWRVTPLGDAAQPHDARHHPASAPRPGLGVGPGAGQGPALRRSTVSGVGSAGTASVEAQTQEALPPLALAGQRQQRASDTGPQQGPGSPLAWRSLPGGGGVAGEAGARGPPLPPRHHSGEGQQQGGQGAQWGAVASQQQQQQQQQEGHAEPCLHSNAAALEKGFELCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVRELACMRAAWAGGRPPTGQLGSVSAQVQRRDSLARVSASRVTSARGTAGGPPPPTHALQLLQVANLSSGGNNKRSSGRDGGAEANGGGGASPGPWAEQPRANHLLDEGNSHDGHDGTSREVPGQEWIGAGDGDGAGESEDSRRRPLPLPLLTTALGSTGTGVGDGSGVARPLKQQLLSPPGGAAAVAALRLKGASVRRRTRQGHQ

HMMSmart: SM00219
IPR020635
786-1243 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LEITDLLGAGTFGKVFKGFWHGTLVAVKHMVFPRGVLLAGAAVGGTGGGGGLGGKPGAGGGAAGAVQLQLERMAAMEAAISTSLSHPNVVQTYTWRVTPLGDAAQPHDARHHPASAPRPGLGVGPGAGQGPALRRSTVSGVGSAGTASVEAQTQEALPPLALAGQRQQRASDTGPQQGPGSPLAWRSLPGGGGVAGEAGARGPPLPPRHHSGEGQQQGGQGAQWGAVASQQQQQQQQQEGHAEPCLHSNAAALEKGFELCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVREL

HMMSmart: SM00220
IPR002290
786-1251 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LEITDLLGAGTFGKVFKGFWHGTLVAVKHMVFPRGVLLAGAAVGGTGGGGGLGGKPGAGGGAAGAVQLQLERMAAMEAAISTSLSHPNVVQTYTWRVTPLGDAAQPHDARHHPASAPRPGLGVGPGAGQGPALRRSTVSGVGSAGTASVEAQTQEALPPLALAGQRQQRASDTGPQQGPGSPLAWRSLPGGGGVAGEAGARGPPLPPRHHSGEGQQQGGQGAQWGAVASQQQQQQQQQEGHAEPCLHSNAAALEKGFELCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVRELACMRAAWA

ProfileScan: PS50011
IPR000719
786-1251 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEITDLLGAGTFGKVFKGFWHGTLVAVKHMVFPRGVLLAGAAVGGTGGGGGLGGKPGAGGGAAGAVQLQLERMAAMEAAISTSLSHPNVVQTYTWRVTPLGDAAQPHDARHHPASAPRPGLGVGPGAGQGPALRRSTVSGVGSAGTASVEAQTQEALPPLALAGQRQQRASDTGPQQGPGSPLAWRSLPGGGGVAGEAGARGPPLPPRHHSGEGQQQGGQGAQWGAVASQQQQQQQQQEGHAEPCLHSNAAALEKGFELCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVRELACMRAAWA

PatternScan: PS00107
IPR017441
792-813 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGTFGKVFKGFWHGTLVAVK

Seg: seg
820-851 seg

GVLLAGAAVGGTGGGGGLGGKPGAGGGAAGAV

Gene3D: G3DSA:3.30.200.20
855-884 no description

LERMAAMEAAISTSLSHPNVVQTYTWRVTP

Seg: seg
901-917 seg

APRPGLGVGPGAGQGPA

Seg: seg
974-989 seg

PGGGGVAGEAGARGPP

Seg: seg
997-1025 seg

GEGQQQGGQGAQWGAVASQQQQQQQQQEG

HMMPfam: PF07714
IPR001245
1039-1243 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

EKGFELCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVREL

Gene3D: G3DSA:1.10.510.10
1044-1246 no description

LCLILELCDMGSLRDHLARGGFRCTHDHGSVDHGAVLDLAMDVARAMSYLHSKNIVHSDLKSRNVLLKSLSGPPGSHGRCCPLVAKVSDFGLAFKMEGEETHVSGMYQGTLAWSAPELLMEGRVSKAADVYSFGVLLWEMYTCGEAFKGIPRPLLAGKVVEGLRPDFPPETPPEYMRLAAACWGHDPAQRPSFDQVVRELACM

FPrintScan: PR00109
IPR001245
1048-1061 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

LELCDMGSLRDHLA

FPrintScan: PR00109
IPR001245
1092-1110 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YLHSKNIVHSDLKSRNVLL

PatternScan: PS00108
IPR008271
1098-1110 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHSDLKSRNVLL

FPrintScan: PR00109
IPR001245
1214-1236 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

TPPEYMRLAAACWGHDPAQRPSF

Seg: seg
1282-1297 seg

TSARGTAGGPPPPTHA

Seg: seg
1307-1333 seg

SSGGNNKRSSGRDGGAEANGGGGASPG

Seg: seg
1368-1381 seg

GAGDGDGAGESEDS

Seg: seg
1382-1408 seg

RRRPLPLPLLTTALGSTGTGVGDGSGV

Seg: seg
1416-1434 seg

LLSPPGGAAAVAALRLKGA

Seg: seg
1464-1483 seg

SDAGGSYTGSGGPDGSEGGP

Seg: seg
1505-1514 seg

GGGGGTGTGT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox