PRGDB00150841 (Cre13.g604350.t1.2)

From PRG Wiki
Jump to: navigation, search
Cre13.g604350.t1.2
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Chlamydomonas reinhardtii

Comment?

PAS domain-containing protein tyrosine kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGACCTGGGTTTCATCCAATCCAAGATGCGACTGGGCAATCACGTCATGTTCGGCATGGAACGGATAGTCATTCAAAGGTACCGCATCGGCAACCAGCTGCAGGCGCCCGGGCTGGACCTGCTGGACATCGGCGCCCCCCGCACACACGCCCTGGTGCTGACACGCGACGTGTATGCCGTACACCGCATCTGTTTCCCGCCGGAGGTGCAAATAACGACGATGCCGCTGGTTCCACGCCCGCCCGACATCCCTGGGCCGCAGCGATACCGGCTGGCAGAGCCCAACCCGCCCGACTGCACCGTGAACGCAGCAGACCCCGCGCCGCGCCGGTGCTGGGCCGCGCGTGGCGTGTACGTTGACGTGGCAACACCCGGGGCGGACCACGCGTCGTACGGCACGGTCTACCCGACCGAGTACGACGTGCACATGGTCAACGTGACGTATTTGTGTGAGCGGGTGATGTCGGCTCAGTGCATCCAGTCGCTGGGCTACCTGGGGTGCGCCTTCAACACCCTGTCCCACATGGACCCGCCCTGGTACCTGTCCGCGGCCCTGGGCGGCGGCGGCGGCGGCGGCGGCGGCAACGCCACCAGCGGCAGCAGCAGCGGCAGCACAGCAGGCAGCAGTATCGGAGGCAGTCGAGGGTTCCCGGCAAGCGGCAGCAGCAGCACCGCCGCTGCTACTGCCGTTGCCACCGCCGTTGCCGCTGGCAGTAGCAGCAATGCTACCGGGAGCGAGAGTCATGACGCGGATGGGCAGGCTTCGACGCCGCTTGTGGCGGCTGCGGACGAGGGCGAGGGTGGCGCGAATGTGGGCGCAATCATTGGCGGCGTGCTGGGAGGCGTGGCGGCGGCTGCCCTGCTTGTGGCAGCGACTGTGCGGGTGTGGCGGCGGCGACAGCAGCGGTCGCCGCTCCAGGCAGCTGCCGCTGCGGATGCCGCCGCCGCGCAGCATTGCGGCAACGGCGGCGGCGGCGGCAAGGGCGACTGCCCTACCTCTGGGAAAGCGGCGACACAGCCGTCGCGTCAGCATCCCCCGCCCTTCAGAGAGGGTCCAGCCGAAGCGCCTGGATACGGGCCAGGCGTGGCCAGCAGCAGCACATCCGTGACCGTGGGGTGGTGCGGGCTGCTGCTGGGCCCCTGTGCGCACTGCAGCGCAGTCGTTGCCACTGCTACAGCCACTGCAGGCGGCAGCAGGGCAGTAGCAGGCGCGGACGGGGCGGGCGGCGGCAGCCGGGCGGCGGGCAAACTCCATCAGGGCCGCAGCAGCAGCAGCAGCAGCAGGCGCATTGGCGCGGCGGACCCTTGCGTGCGGCTACAGGCTCAGTCGGCGAGCACCGCCACGCCTGCTAAGCAGAGCTTGGAAGCACGGGTGGAGTCGGTGCTGCGGGACTTTGCCGTCGCGGTCGGGGGCCCGGAGGCCGGCGGCGTGGGCCGGGGCGCGGGCGTGGGCGCCGGCGCCGGCGGGTTGGCGGGTGGAGGCCCCGACGTCCGCGTCAGTACTGCTGGTGGCGCCGCTGCACCCGCGGCGGCACCGGGTGCAGCGGCGGCGGCGCCGCTGGCTGCGTTGCTGGCCGCTGTGATGACCGCAGGCGCGTCTGTGCACCATGCCGCTGCTACCGTCGGTGGCGGCGCCGGCTCGCCGGCACACTCCGGCCCCATCCGCAGCTCACCCATGGCAATGGACGCGGCCGCGCCGTCGGCGCCCTGGTTTGCGCCGGTGCCGTCTGCGTCTTCTGTGCTTGCGCCCAGCGCCCCCAAAAGCCGGACCGTGGCGGCCGGCGCCGGCCATGCTTGCAGGCGCCCGGAGGCGCCGGCGTCCGCGACCGCGGTCGCCGGGGTGGGGGGACTGGCGACGGCAGGCGGCGCCGCCGGCGGCGGCGGCGGCGGCGCGGTGCCGGAACGGCAGGGGGCGGCGCCGCTGTGTTGTGATGCGGCTGGGAGTGAGACCGCGCTGGCGGGGCCGCCGGAGCCTGGTGGCGGCGGCGGCGACGGCGCGGGGCCGGCATCTTCGTCGCACAACTGTAAATTCTTCATGCATATTACAGAGGACCTGGATGCCCTGGCCAGCCAGACCGACATGCTGGTCACGCCCTTCACACCCGCCCGACCCGACGTCAACCTCTCCGCCATCCTGCTGCCGTACGTCTCCCCAGCCGCCTCAGCCGCCCTGCCCAACCTGCCCGCCCCTGGGCAACCCACGCCGGCTGCCGCCCCCGCCCCCGCCGCCGCGCCCCAAGCTGCGTGCACGGCCGCCGAGGCCTGCGGCGCGGCTGCAGCAGCAGCTGCTGTGGCAAACGGAGCAGCTCTTGCTGCCGGTGGGTTGCAGGCGCAAGTGTGTCCACTGTCACTCAGGGCAGCGCCGCCTGCCGCTGCCGCTACTGAAGCCGCCGGTGTAGCTGCTGCTGCCCCCGGCTGGGGCGGGCTGGCAGCAGTCGGCTCGGCTGCCGTCACACGCGGAGGCTCAACAGAGGGCGCCCTGATGGACTGCCATGTGCAGCTGACCAATGTGGTGCGGGGCCGCGGCTCCTTCGGCAAGGTGGTGGAGGGAACGTACAGAGGCGAGCGGGTAGCTGTGAAGCTCATGCGCCGGACCGTGGACGCCGCAGACTGCGGTGGCGCAGGCGAGGGCGGCGCCGGTGAGGGCGGCGACGGCGCCCGCGGTGGAGGAGGAGGCGGCGGAGGCGGCGAAGGTCGCGGCGCGTTCAGCCGCATGGTCACGGCTTTCAGGCAGGAAGTCGAGGTGCTGGCGCGGTTGACGCACCCCAACGTGGTGCGGCTGCTGGCGGCGTGCATGACGCCGCCTCGCTTCTGCCTGGTCATGGAGTTGATGGAGACGAGTTTGGAGGGGCTGCTTAAGGCAACGCCGGGGCGATTGCTGCCGCTCAATGCGGTGATGGGCATCGCGGTGGACGTGGCGAGAGGGCTGCAGTACCTGCACCCCACCATCGTGCACCGCGACCTGAAGCCCGCCAACGTGCTGGTGGGGGACCCGCTGGGGCCGCGGCAGGTGGCGAAGCTTTCGGACTTTGGACTTGCGCGGCTGCGCTCCAGCGTCGTCGTGACGTGCAACCCGGAGGCGGGCACGCCCCCCTACATGGCCCCCGAATGCTTCGACGCCACCGCCACCTCGCTGACACACCACGTGGACGCCTACTCCTTCGGCGTGCTGCTGTGGGCAATGCTGTCGGGTCAGGAGCCGTGGGCCGGCCTGGACTGTGTGTCGCTGGCCTACCGGGTGGCCTACGGTGGCGAGCGGCCGCCGCTGGACGCCATCCCGCCCGACCGCCGCCCGCCCAAACTGGTGCGGCTCGTGGCGCAGTGCTGGGAGGCAGACCCCAAGCGCAGGCCCGCGGCGGCTGAGATGGTGAAGGAGTTGCTGCTGGTCCGCCAGATGTTCGCCCGCGGCCTGGCAGTAGCAGACATGCTGGACACACAGGTGGATGGCAGCGGCACCTTCCGCGGCGCAGCAGCGGCTGTAGCAGCCAGTGGCGCCGCGGGGCAGGGGCCCTCCCAGAAGCGGCTGCTGCTACAGCCGGGTCTGCTAGCAGCGGTCGGCGCCGCCGCGGCTGCCGAGCTCCACCCCGGCCCCGAAAGGGTGGACCCCGAGGTGGCCACGGCGGCTGTAGCAGCTGCGCTGCTGGGCGGCGCTGCGGCGGGCGCGGCTGCAGCAGCGGGTGGGGAGGCCGCGGCAGCGGGCGCGCCGGCCGCGGAAGCAGCCGTAGCACTCGCGGCAGGTGCCCGCGACCCGACCGTGGCGGCGCTGGCCAGGCTGCGGGTGCCGGTGCCGCTGGGCCGCCGCCGCGGCGCTGGCTCGCAGCCGCCGGCCGGCGGCTCGGCCCTGACGCCGGAGCAGGTGAGGTCGGAGGCGGCGCGAATGTGTGAGAACGCCTCGCTTTACCAATACGGTGATGAGGACGATGCCGATTACCTCGGGTACGGACGGGCGTGGCAGCTGGGGAGCAGCTGGCTGGCGGGGTCGCCGTCGGCGACTGCGACGGCGTCGGCGGCGGGCGGCAGCGGCGGCGCCAGCACGGCCGCCGCTGCATCTGCTGCTGGGACGTCGGGGGAGCAGCTCACCATCGCGGTGCAACAGCAGCAATAA


Protein sequences

Name Description Sequence
Cre13.g604350.t1.2 PAS domain-containing protein tyrosine kinase family protein (best arabidopsis hit)

MDLGFIQSKMRLGNHVMFGMERIVIQRYRIGNQLQAPGLDLLDIGAPRTHALVLTRDVYAVHRICFPPEVQITTMPLVPRPPDIPGPQRYRLAEPNPPDCTVNAADPAPRRCWAARGVYVDVATPGADHASYGTVYPTEYDVHMVNVTYLCERVMSAQCIQSLGYLGCAFNTLSHMDPPWYLSAALGGGGGGGGGNATSGSSSGSTAGSSIGGSRGFPASGSSSTAAATAVATAVAAGSSSNATGSESHDADGQASTPLVAAADEGEGGANVGAIIGGVLGGVAAAALLVAATVRVWRRRQQRSPLQAAAAADAAAAQHCGNGGGGGKGDCPTSGKAATQPSRQHPPPFREGPAEAPGYGPGVASSSTSVTVGWCGLLLGPCAHCSAVVATATATAGGSRAVAGADGAGGGSRAAGKLHQGRSSSSSSRRIGAADPCVRLQAQSASTATPAKQSLEARVESVLRDFAVAVGGPEAGGVGRGAGVGAGAGGLAGGGPDVRVSTAGGAAAPAAAPGAAAAAPLAALLAAVMTAGASVHHAAATVGGGAGSPAHSGPIRSSPMAMDAAAPSAPWFAPVPSASSVLAPSAPKSRTVAAGAGHACRRPEAPASATAVAGVGGLATAGGAAGGGGGGAVPERQGAAPLCCDAAGSETALAGPPEPGGGGGDGAGPASSSHNCKFFMHITEDLDALASQTDMLVTPFTPARPDVNLSAILLPYVSPAASAALPNLPAPGQPTPAAAPAPAAAPQAACTAAEACGAAAAAAAVANGAALAAGGLQAQVCPLSLRAAPPAAAATEAAGVAAAAPGWGGLAAVGSAAVTRGGSTEGALMDCHVQLTNVVRGRGSFGKVVEGTYRGERVAVKLMRRTVDAADCGGAGEGGAGEGGDGARGGGGGGGGGEGRGAFSRMVTAFRQEVEVLARLTHPNVVRLLAACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVKELLLVRQMFARGLAVADMLDTQVDGSGTFRGAAAAVAASGAAGQGPSQKRLLLQPGLLAAVGAAAAAELHPGPERVDPEVATAAVAAALLGGAAAGAAAAAGGEAAAAGAPAAEAAVALAAGARDPTVAALARLRVPVPLGRRRGAGSQPPAGGSALTPEQVRSEAARMCENASLYQYGDEDDADYLGYGRAWQLGSSWLAGSPSATATASAAGGSGGASTAAAASAAGTSGEQLTIAVQQQQ*

Domains

Domain Start-End Description Sequence

Seg: seg
183-216 seg

SAALGGGGGGGGGNATSGSSSGSTAGSSIGGSRG

Seg: seg
219-246 seg

ASGSSSTAAATAVATAVAAGSSSNATGS

Seg: seg
265-292 seg

EGEGGANVGAIIGGVLGGVAAAALLVAA

Seg: seg
308-317 seg

AAAAADAAAA

Seg: seg
321-329 seg

GNGGGGGKG

Seg: seg
351-362 seg

EGPAEAPGYGPG

Seg: seg
365-372 seg

SSSTSVTV

Seg: seg
386-416 seg

SAVVATATATAGGSRAVAGADGAGGGSRAAG

Seg: seg
422-430 seg

RSSSSSSRR

Seg: seg
467-495 seg

AVAVGGPEAGGVGRGAGVGAGAGGLAGGG

Seg: seg
503-527 seg

AGGAAAPAAAPGAAAAAPLAALLAA

Seg: seg
530-554 seg

TAGASVHHAAATVGGGAGSPAHSGP

Seg: seg
557-587 seg

SSPMAMDAAAPSAPWFAPVPSASSVLAPSAP

Seg: seg
609-633 seg

ATAVAGVGGLATAGGAAGGGGGGAV

Seg: seg
652-670 seg

ALAGPPEPGGGGGDGAGPA

Seg: seg
718-780 seg

SPAASAALPNLPAPGQPTPAAAPAPAAAPQAACTAAEACGAAAAAAAVANGAALAAGGLQAQV

Seg: seg
787-814 seg

AAPPAAAATEAAGVAAAAPGWGGLAAVG

HMMSmart: SM00220
IPR002290
833-1134 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VQLTNVVRGRGSFGKVVEGTYRGERVAVKLMRRTVDAADCGGAGEGGAGEGGDGARGGGGGGGGGEGRGAFSRMVTAFRQEVEVLARLTHPNVVRLLAACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVKELLLVRQMF

HMMSmart: SM00219
IPR020635
833-1127 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VQLTNVVRGRGSFGKVVEGTYRGERVAVKLMRRTVDAADCGGAGEGGAGEGGDGARGGGGGGGGGEGRGAFSRMVTAFRQEVEVLARLTHPNVVRLLAACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVKEL

ProfileScan: PS50011
IPR000719
834-1129 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

QLTNVVRGRGSFGKVVEGTYRGERVAVKLMRRTVDAADCGGAGEGGAGEGGDGARGGGGGGGGGEGRGAFSRMVTAFRQEVEVLARLTHPNVVRLLAACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVKELLL

superfamily: SSF56112
IPR011009
841-1125 Protein kinase-like (PK-like)
Protein kinase-like domain

GRGSFGKVVEGTYRGERVAVKLMRRTVDAADCGGAGEGGAGEGGDGARGGGGGGGGGEGRGAFSRMVTAFRQEVEVLARLTHPNVVRLLAACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVK

HMMPfam: PF00069
IPR000719
841-1126 Pkinase,Ser-thr
Protein kinase, catalytic domain

GRGSFGKVVEGTYRGERVAVKLMRRTVDAADCGGAGEGGAGEGGDGARGGGGGGGGGEGRGAFSRMVTAFRQEVEVLARLTHPNVVRLLAACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVKE

Seg: seg
868-902 seg

DAADCGGAGEGGAGEGGDGARGGGGGGGGGEGRGA

Gene3D: G3DSA:3.30.200.20
906-930 no description

MVTAFRQEVEVLARLTHPNVVRLLA

HMMPanther: PTHR23257:SF309
913-1136 PREDICTED PROTEIN (FRAGMENT)

EVEVLARLTHPNVVRLLAACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVKELLLVRQMFAR

HMMPanther: PTHR23257
913-1136 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

EVEVLARLTHPNVVRLLAACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVKELLLVRQMFAR

Gene3D: G3DSA:1.10.510.10
931-1129 no description

ACMTPPRFCLVMELMETSLEGLLKATPGRLLPLNAVMGIAVDVARGLQYLHPTIVHRDLKPANVLVGDPLGPRQVAKLSDFGLARLRSSVVVTCNPEAGTPPYMAPECFDATATSLTHHVDAYSFGVLLWAMLSGQEPWAGLDCVSLAYRVAYGGERPPLDAIPPDRRPPKLVRLVAQCWEADPKRRPAAAEMVKELLL

PatternScan: PS00108
IPR008271
984-996 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKPANVLV

Seg: seg
1156-1170 seg

GAAAAVAASGAAGQG

Seg: seg
1176-1198 seg

LLLQPGLLAAVGAAAAAELHPGP

Seg: seg
1204-1248 seg

EVATAAVAAALLGGAAAGAAAAAGGEAAAAGAPAAEAAVALAAGA

Seg: seg
1256-1281 seg

LARLRVPVPLGRRRGAGSQPPAGGSA

Seg: seg
1326-1357 seg

AGSPSATATASAAGGSGGASTAAAASAAGTSG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox