PRGDB00150845 (Cre13.g574300.t1.2)

From PRG Wiki
Jump to: navigation, search
Cre13.g574300.t1.2
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Chlamydomonas reinhardtii

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGCCACAGTCAGAACCGGAGGAAAACTTAAAGCTGGAGGATAGCGAGGAGCCTGAGAGGGCTAAAGCTCCTCCACCGCGACTGTCTGTGGGCGATGCGGCTCAAGCGGCCAGTGCCGGAAAGCACCGTGGATGCCGCGGCTGCTGGGCAAGCCTCCACGATACGCTTACGGAGCTCTGGGAAATCATCAAGCTTTACCCCAGCACAATTATTGTGCCCCTGTTCGTCTTCGGCATCATCTGCGGGTTGGGCATCTGGGGCGTCATGGCCGGGGCAGACTCATACGTGCATCAACAGAAGGACGACGTGCACAGCCATGCAGTGGACGCGGTGACAGGCTTCCAGATCCAGCTGCAGCAGTCCTTCACGCCTGGTGTCACAATGCAAATGCTGGTGAAGCAGAGGCCAGACTGGGACTACTGGGTGCAGAACTTTGACTCCACTGCTACGGAGCTCATGTCCCGTGTGCCGAAGGGTGCGCTGTGGAATCTGCAGCTACAGCCGTTTGCGCAGGTCATGATGATCAGCCCACTACGGCCGGAGGACGTGTCTCAAATTTCCCCACCCCGCGACCTGATTGGAGATCCCACACGCCGTGACGGCATCATGAACATCATCCAAACACGGGAACCAGGTGTGAATGGGCCATTCTACTTGGTCCAGGGCTTCACAGGTGCGTTTGTGCGCTACCCCATCTATGTGCCAAACGTCAGCGAGACGGAGACGTTCGGGTTCCACTACAAGGAAAACGCCACCGCCATCCCCTACTCGGAGCTCCCGGCCAGCGTGCGCAGCTGCACCATCTGCTACAACGCCACCACACGTGAAAAGTGGTGGGGCTTGCTGACGGTGCTGGTGAACTATGATGAGGTCACCAACGGCCAGGATGCTTATCTGGCAACGCTCCGTAATATGGATTTTCACTACGCGTTGGTCCGGCCCATCAACGCCACGGCGGAGCAGGTGATTGCGCAGGTGGGCCCCACCTCCCTGCGCGACGAGGACGCGGTCACCGTGGAGGTCAAGGTGCTGAGCGCCGTGTGGCAGCTGAGGGTGGCCCCAGCCAACGGCTTTGAGCCATCGTGGCGGGACCCGCTAATCGCAGCGGTGGTCATTGTCTCGTTCATCATTGCAGCGCTGCTCTTTGTGACGATGGCCTCTTTCAAGCGGCAGCGGCTGCTGCTGCAACAGACAGTGGCCGCAAATCGAAACCTGGCGGAGACGACTAAGCGCCTGGAGGAGGAGAAGGAGCGCATGGATGTGCTGCTGGTGCGGCAATACGACCTGCTGAGGTGCCTGGACGCAAACCGCTCCAAACGCCACGGTGGCGGCCACGACAGCAGCGACGATGCAATGTCCGCATCCAAGCGAGCCATGATGACCCGCATTGAGGACGCGCGCCGCTCGCTGAACGTGGCCAAGTCATCCATTGAGGACCCCATCCAGGTCTTTGAGATCCTGGGCGCTGGAGCGTTCGGCAAGGTGCAGCGTGGCCTGTGGCGCGGCACGGTGGTGGCGGTGAAGACCATGATCCTGCCGGCCAACATGACGGGGCAGGAGAAGCGCGAGAAGATGGCGGTGATGGAGGCAGCCATCAGCAGCAGTCTTGTGCACCCCAACATCGTGACCACCTACACCTACTTCATCCGCCCGTATCACGAGCCCACACACGATGGTGTTCAGAACATGCTAGCCGTGCCCAGCTTGACCAACCCCACAAATCCGAGCCGTCAGACATCAGATCCACAATCCATTCTCGCGGAGAGTGTTGCATCGGACAGCACCATTCACAGCTATGAGGTGCGCCTGGTGTTGGAGTTCTGTGACAAGGGGTCGCTCAAGGACGCGCTGGACCAGTCCGCCTTCATGCAGGGTGGCGCCCTGAACCTGGCGGCGATGCTGGAGACGGCCGCGGACGTGGCCAAAGCCATGGTGCACATGCACGCGGCCAACGTGCTGCACAGCGACCTCAAGGCCCGCAACATCATGCTCAAGAGCAGCGGCACAGAGGGCCGCGGCATCGTGGCGAAGGTGGCCGACTTTGGTCTGTCCACGCGCATGGAGCACCAGGAGACGCACCTGAGCAGCTGCTTCCAGGGCACGCTGACGCACATGGCTCCGGAGGTGATGCTGGAGGGCCGCATCAGCAAGGCCGCGGACGTGTACTCGTTTGGCATTCTCCTGTGGGAGTTGTTCTGCGCCGGCGACCCGTTCCAGGGCGTGCCGCGTGCGCACCTGGGTCACGCAATCACCAAGGAGGCGCGGCGGCCCAAGTTCCCGCCCTTCGCTCCGGCGGGCTTCGTGCGGCTCGCGACGCGTTGCTGGGACCCCGATGTCTCGCAGCGGCCCACGTTTGAGGAGGTGCTGTCAGAGCTGGTGCGCATGCGCGAGGAGCTGGGCGGAGACACTCAGCAGCTCACTATCATTCCACCAAAGCCCGCCCAGTCGTCTTCGGCTATGTCGATGGTGTCTGGGCAGCAACACCAGCAGCAGCACCAGCACGCAAGTGGCGACAGTGGGGACAGCAGCGGCAGCGGCAAGATCGTGCTCGGCGGCGCTGGCAGCAACGCCACGTACACCAACCCGCTGGCGTTGTTCGGAGCGGGCATTGTGGTGGGCGGCAGCACCAGCGGTAGCACAACGGGTAGCTTCGGTAGCTTGCCGGGCCAGGGCGTTGGGCACTCGGCGGTGGCGCAGCGCTTGGTCATGAAGAGCGCCCTGGCGCAGCGGCACCTGCGCAAGATGGGCGTGCGCACTAACGGCAGTCCGGGACTGGGGCTCAGCCTTGCCCCCGCGATGCCAGCGCTGCAGGAAGATCAAGAGCAGGAGGGCACGGGCAGCGACCGGGACGGCTCCCTACGGGCATGCGCTGAAGTTGGGTCGGAGGGAGGAGGTGGAAGCAGAGCTGAAGGCGAGGGTGGAGGACCGACGGCAGGAGCAGCTGATGGACGTGCAGAAGAGGTAAAAGGAGGTAACGGGGACGTGATTGAGCTAGCAGGCGGGCACGATCCCCAGAAAACCAGTTCAGGTCAAACCGCAGTTGATGTTGTAAGGTTGCATGGGGCTGACTCCGTATGA


Protein sequences

Name Description Sequence
Cre13.g574300.t1.2 Protein kinase superfamily protein (best arabidopsis hit)

MPQSEPEENLKLEDSEEPERAKAPPPRLSVGDAAQAASAGKHRGCRGCWASLHDTLTELWEIIKLYPSTIIVPLFVFGIICGLGIWGVMAGADSYVHQQKDDVHSHAVDAVTGFQIQLQQSFTPGVTMQMLVKQRPDWDYWVQNFDSTATELMSRVPKGALWNLQLQPFAQVMMISPLRPEDVSQISPPRDLIGDPTRRDGIMNIIQTREPGVNGPFYLVQGFTGAFVRYPIYVPNVSETETFGFHYKENATAIPYSELPASVRSCTICYNATTREKWWGLLTVLVNYDEVTNGQDAYLATLRNMDFHYALVRPINATAEQVIAQVGPTSLRDEDAVTVEVKVLSAVWQLRVAPANGFEPSWRDPLIAAVVIVSFIIAALLFVTMASFKRQRLLLQQTVAANRNLAETTKRLEEEKERMDVLLVRQYDLLRCLDANRSKRHGGGHDSSDDAMSASKRAMMTRIEDARRSLNVAKSSIEDPIQVFEILGAGAFGKVQRGLWRGTVVAVKTMILPANMTGQEKREKMAVMEAAISSSLVHPNIVTTYTYFIRPYHEPTHDGVQNMLAVPSLTNPTNPSRQTSDPQSILAESVASDSTIHSYEVRLVLEFCDKGSLKDALDQSAFMQGGALNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLSELVRMREELGGDTQQLTIIPPKPAQSSSAMSMVSGQQHQQQHQHASGDSGDSSGSGKIVLGGAGSNATYTNPLALFGAGIVVGGSTSGSTTGSFGSLPGQGVGHSAVAQRLVMKSALAQRHLRKMGVRTNGSPGLGLSLAPAMPALQEDQEQEGTGSDRDGSLRACAEVGSEGGGGSRAEGEGGGPTAGAADGRAEEVKGGNGDVIELAGGHDPQKTSSGQTAVDVVRLHGADSV*

Domains

Domain Start-End Description Sequence

Seg: seg
16-27 seg

EEPERAKAPPPR

ProfileScan: PS50839
IPR006189
167-245 CHASE
CHASE

QPFAQVMMISPLRPEDVSQISPPRDLIGDPTRRDGIMNIIQTREPGVNGPFYLVQGFTGAFVRYPIYVPNVSETETFGF

HMMPfam: PF03924
IPR006189
191-237 CHASE
CHASE

DLIGDPTRRDGIMNIIQTREPGVNGPFYLVQGFTGAFVRYPIYVPNV

Seg: seg
366-381 seg

LIAAVVIVSFIIAALL

Coil: coil
395-426 coiled-coil

LQQTVAANRNLAETTKRLEEEKERMDVLLVRQ

Seg: seg
405-418 seg

LAETTKRLEEEKER

superfamily: SSF56112
IPR011009
453-815 Protein kinase-like (PK-like)
Protein kinase-like domain

SASKRAMMTRIEDARRSLNVAKSSIEDPIQVFEILGAGAFGKVQRGLWRGTVVAVKTMILPANMTGQEKREKMAVMEAAISSSLVHPNIVTTYTYFIRPYHEPTHDGVQNMLAVPSLTNPTNPSRQTSDPQSILAESVASDSTIHSYEVRLVLEFCDKGSLKDALDQSAFMQGGALNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLSELVRMREELGGDTQQLTIIPPKPAQ

HMMSmart: SM00220
IPR002290
481-793 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

IQVFEILGAGAFGKVQRGLWRGTVVAVKTMILPANMTGQEKREKMAVMEAAISSSLVHPNIVTTYTYFIRPYHEPTHDGVQNMLAVPSLTNPTNPSRQTSDPQSILAESVASDSTIHSYEVRLVLEFCDKGSLKDALDQSAFMQGGALNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLSELV

HMMSmart: SM00219
IPR020635
481-792 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IQVFEILGAGAFGKVQRGLWRGTVVAVKTMILPANMTGQEKREKMAVMEAAISSSLVHPNIVTTYTYFIRPYHEPTHDGVQNMLAVPSLTNPTNPSRQTSDPQSILAESVASDSTIHSYEVRLVLEFCDKGSLKDALDQSAFMQGGALNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLSEL

ProfileScan: PS50011
IPR000719
481-799 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IQVFEILGAGAFGKVQRGLWRGTVVAVKTMILPANMTGQEKREKMAVMEAAISSSLVHPNIVTTYTYFIRPYHEPTHDGVQNMLAVPSLTNPTNPSRQTSDPQSILAESVASDSTIHSYEVRLVLEFCDKGSLKDALDQSAFMQGGALNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLSELVRMREEL

Gene3D: G3DSA:3.30.200.20
481-553 no description

IQVFEILGAGAFGKVQRGLWRGTVVAVKTMILPANMTGQEKREKMAVMEAAISSSLVHPNIVTTYTYFIRPYH

HMMPfam: PF00069
IPR000719
482-790 Pkinase,Ser-thr
Protein kinase, catalytic domain

QVFEILGAGAFGKVQRGLWRGTVVAVKTMILPANMTGQEKREKMAVMEAAISSSLVHPNIVTTYTYFIRPYHEPTHDGVQNMLAVPSLTNPTNPSRQTSDPQSILAESVASDSTIHSYEVRLVLEFCDKGSLKDALDQSAFMQGGALNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLS

PatternScan: PS00107
IPR017441
487-508 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGAFGKVQRGLWRGTVVAVK

Gene3D: G3DSA:1.10.510.10
601-793 no description

VRLVLEFCDKGSLKDALDQSAFMQGGALNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLSELV

FPrintScan: PR00109
IPR001245
605-618 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

LEFCDKGSLKDALD

HMMPanther: PTHR23257
628-794 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

LNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLSELVR

HMMPanther: PTHR23257:SF343
628-794 PREDICTED PROTEIN

LNLAAMLETAADVAKAMVHMHAANVLHSDLKARNIMLKSSGTEGRGIVAKVADFGLSTRMEHQETHLSSCFQGTLTHMAPEVMLEGRISKAADVYSFGILLWELFCAGDPFQGVPRAHLGHAITKEARRPKFPPFAPAGFVRLATRCWDPDVSQRPTFEEVLSELVR

FPrintScan: PR00109
IPR001245
646-664 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

HMHAANVLHSDLKARNIML

PatternScan: PS00108
IPR008271
652-664 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHSDLKARNIML

FPrintScan: PR00109
IPR001245
719-741 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

ADVYSFGILLWELFCAGDPFQGV

Seg: seg
754-765 seg

ARRPKFPPFAPA

FPrintScan: PR00109
IPR001245
763-785 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

APAGFVRLATRCWDPDVSQRPTF

Seg: seg
826-834 seg

QQHQQQHQH

Seg: seg
836-846 seg

SGDSGDSSGSG

Seg: seg
873-886 seg

GGSTSGSTTGSFGS

Seg: seg
957-985 seg

AEVGSEGGGGSRAEGEGGGPTAGAADGRA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox