PRGDB00150846 (Cre18.g748600.t1.2)

From PRG Wiki
Jump to: navigation, search
Cre18.g748600.t1.2
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class N
Domain Type NBS
Gene Species Chlamydomonas reinhardtii

Comment?

pleiotropic drug resistance 2 (best arabidopsis hit)

DNA Sequence

ATGGCAGACTACAAGAATGCCTTCATTGCTGAGCCCAACGCCATCGGCGTTGAGGGCGTGTTCGGCATCGTTCCCACGCGTGAAGCGTTCGCCCTCCAGGAAAATGACCTGGCGACGCGGCTGTTCCCGACCTCAGCCCAGTACACGGATGAGATTGGCTCCAGTGCCCCCTCCTCGGCCGTCCTGTCGCGCATGAGTCAGGCGCAGGTACATCGCCTGCACCACAGGCTGAGTCAGCTCCCCCCCGATGAGGCGGCGCTGATGGAAGCTGCGGTGGATGAGGCGGTGCACAAGCGGCTGCGGCCGCTGAAGGAGCTGCAGGAGCTGGACAAGAAGGTGCAGGCTGCGGACGAGCAGCTCAAGGAGTACGGCGGCTTCACTGCGGCCATGGGCGCGCGCATGCGGGCTCTGGGCGTGTCGATGCCCTCCGTCACGCTCGAGTACCGCGACCTGGCTGTGCACACGGACGCACTGGTGGGCAGTGCCGGCATACCCTCCGTGGGCAACTCCCTGCTGGGCATATTCAAGCGGCTGGTGTGTGTCAAGAGCAACACAGTGGACCACCCCATCCTGGACGGCCTCAGCGGCGTGCTGCGCCCCGGCCGCCCCACGCTGCTGCTGGGGCCGCCCTCCTCCGGCAAGTCCAGCCTGCTCAAGCTGTCTGACGACGAGCTGCTCAAGCTGATGGACGAGACGTACGACAGCGGCATCCGTACACTGGGCGCCATGCGGGCCATGGGCATCGCACACACCGCCAACACGCCCGTGGGGGACGCCATGCTGCGCGGCGTGAGCGGAGGCGAGCGCAAGCGCGTCACCACTGCCGAGATGCTGGTGGGCCCGCGCCGCGTGCTGCTGCTTGACGAGATCAGCACCGGCCTGGACAGCGCCACACTCTACTCCATTGCCGACCTGCTGTGCAAGTTCTGCCGGCTGTTCGGCACCACGGTGCTGGTCAGCCTGCTGCAGCCTCCGCCCGAGGTGTACTTCCTGTTTGACGACGTCGTGCTCACCAGCGCCGGCCACATCACCTACCACGGCCCGCCGGCGGGCGCGCTGCCCTTCTACCAGCAGCTGGGGTTCGTGTGCCCGCCGCGCAAGGACGTCCCCTCCTTCCTGCAGGAGATCACCACCGCCTCAGGCCAGCAGGAGTACGCATCTGACGAGCTGCGCGCGCGACTGGGACTGCCCAGGCCCGGCGCCGCCGCCACCCCGGGCGTCTCCTCGCCGCCCTCTCAGAGCAAGGCCGCCGCCGCCGCCCTGGAAATTTCCAAGCCACAGGCGGTGGCGGAGGGCGCCGAAGGCGCCGCCACTGCCGCCGCCACCGCGGCGGCGGCCTGCAGCGGCGGCACTCGCTGGGTGATTCCGCCGTCTCAGGTGGCGGAGGCGTTCTGGCGGGACACGGAGGCGGGCCGCGACATGCGGAGGCTGCTGGAGCAGCCGTTCGACAAGGCCAAGGGGCACCCCGCGGCGCTGGTGCGCACCCGCTATGCGCTGGGTCACCTGGAGGCGCTGGCGGTGGTGGTGCGGCGGCAGCTGCTGCTGGTGTCGCGCGACACCATCCTCATCAAGGGGCGGCTGATGCAGGTGGTGGTGATGGGCCTCATCACCGGCTCGCTGTTCTTCCAGCTGGGCACCTCGGTCAGCGACGCGCGCGCCTACTTCGGCGTGTCCTTCCTGGCCGTCATGTTCATGGCCATGGGCGCCATGCCCGCACTGCCCGTCACACTGGCCACAAAGGGTGTGTGGGAGAAGCACCGCACCGCATACTTCTACCCCGCCTGGTGCCACGCGCTGGGTGCCAACCTGGCGCAGGTGCCCATGATGGTCGTGGACTCGCTCGCCTACTCACTCATCCTGTACTGGATGGTGGGCTACACCCCCGTGGCCGGCCAGTTCTTTGCCTTCTGGCTGGCCATGTTCTCCATGAGCCTCAACTCCAACGTGCTGTTCAGGCTGATTGCCTACGCCTCTCCGGACGCGGTGAGCGCCAACGCCTTCGGCGGCTTCGTGCTGCTCATCCTCATCGTGCTGTCCGGATTCGCCATCATCCGGGGTTGGTGA


Protein sequences

Name Description Sequence
Cre18.g748600.t1.2 pleiotropic drug resistance 2 (best arabidopsis hit)

MADYKNAFIAEPNAIGVEGVFGIVPTREAFALQENDLATRLFPTSAQYTDEIGSSAPSSAVLSRMSQAQVHRLHHRLSQLPPDEAALMEAAVDEAVHKRLRPLKELQELDKKVQAADEQLKEYGGFTAAMGARMRALGVSMPSVTLEYRDLAVHTDALVGSAGIPSVGNSLLGIFKRLVCVKSNTVDHPILDGLSGVLRPGRPTLLLGPPSSGKSSLLKLSDDELLKLMDETYDSGIRTLGAMRAMGIAHTANTPVGDAMLRGVSGGERKRVTTAEMLVGPRRVLLLDEISTGLDSATLYSIADLLCKFCRLFGTTVLVSLLQPPPEVYFLFDDVVLTSAGHITYHGPPAGALPFYQQLGFVCPPRKDVPSFLQEITTASGQQEYASDELRARLGLPRPGAAATPGVSSPPSQSKAAAAALEISKPQAVAEGAEGAATAAATAAAACSGGTRWVIPPSQVAEAFWRDTEAGRDMRRLLEQPFDKAKGHPAALVRTRYALGHLEALAVVVRRQLLLVSRDTILIKGRLMQVVVMGLITGSLFFQLGTSVSDARAYFGVSFLAVMFMAMGAMPALPVTLATKGVWEKHRTAYFYPAWCHALGANLAQVPMMVVDSLAYSLILYWMVGYTPVAGQFFAFWLAMFSMSLNSNVLFRLIAYASPDAVSANAFGGFVLLILIVLSGFAIIRGW*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF90
1-685 PREDICTED PROTEIN,PREDICTED PROTEIN

MADYKNAFIAEPNAIGVEGVFGIVPTREAFALQENDLATRLFPTSAQYTDEIGSSAPSSAVLSRMSQAQVHRLHHRLSQLPPDEAALMEAAVDEAVHKRLRPLKELQELDKKVQAADEQLKEYGGFTAAMGARMRALGVSMPSVTLEYRDLAVHTDALVGSAGIPSVGNSLLGIFKRLVCVKSNTVDHPILDGLSGVLRPGRPTLLLGPPSSGKSSLLKLSDDELLKLMDETYDSGIRTLGAMRAMGIAHTANTPVGDAMLRGVSGGERKRVTTAEMLVGPRRVLLLDEISTGLDSATLYSIADLLCKFCRLFGTTVLVSLLQPPPEVYFLFDDVVLTSAGHITYHGPPAGALPFYQQLGFVCPPRKDVPSFLQEITTASGQQEYASDELRARLGLPRPGAAATPGVSSPPSQSKAAAAALEISKPQAVAEGAEGAATAAATAAAACSGGTRWVIPPSQVAEAFWRDTEAGRDMRRLLEQPFDKAKGHPAALVRTRYALGHLEALAVVVRRQLLLVSRDTILIKGRLMQVVVMGLITGSLFFQLGTSVSDARAYFGVSFLAVMFMAMGAMPALPVTLATKGVWEKHRTAYFYPAWCHALGANLAQVPMMVVDSLAYSLILYWMVGYTPVAGQFFAFWLAMFSMSLNSNVLFRLIAYASPDAVSANAFGGFVLLILIVLSGFAIIR

HMMPanther: PTHR19241
1-685 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

MADYKNAFIAEPNAIGVEGVFGIVPTREAFALQENDLATRLFPTSAQYTDEIGSSAPSSAVLSRMSQAQVHRLHHRLSQLPPDEAALMEAAVDEAVHKRLRPLKELQELDKKVQAADEQLKEYGGFTAAMGARMRALGVSMPSVTLEYRDLAVHTDALVGSAGIPSVGNSLLGIFKRLVCVKSNTVDHPILDGLSGVLRPGRPTLLLGPPSSGKSSLLKLSDDELLKLMDETYDSGIRTLGAMRAMGIAHTANTPVGDAMLRGVSGGERKRVTTAEMLVGPRRVLLLDEISTGLDSATLYSIADLLCKFCRLFGTTVLVSLLQPPPEVYFLFDDVVLTSAGHITYHGPPAGALPFYQQLGFVCPPRKDVPSFLQEITTASGQQEYASDELRARLGLPRPGAAATPGVSSPPSQSKAAAAALEISKPQAVAEGAEGAATAAATAAAACSGGTRWVIPPSQVAEAFWRDTEAGRDMRRLLEQPFDKAKGHPAALVRTRYALGHLEALAVVVRRQLLLVSRDTILIKGRLMQVVVMGLITGSLFFQLGTSVSDARAYFGVSFLAVMFMAMGAMPALPVTLATKGVWEKHRTAYFYPAWCHALGANLAQVPMMVVDSLAYSLILYWMVGYTPVAGQFFAFWLAMFSMSLNSNVLFRLIAYASPDAVSANAFGGFVLLILIVLSGFAIIR

ProfileScan: PS50893
IPR003439
176-365 ABC_TRANSPORTER_2
ABC transporter-like

KRLVCVKSNTVDHPILDGLSGVLRPGRPTLLLGPPSSGKSSLLKLSDDELLKLMDETYDSGIRTLGAMRAMGIAHTANTPVGDAMLRGVSGGERKRVTTAEMLVGPRRVLLLDEISTGLDSATLYSIADLLCKFCRLFGTTVLVSLLQPPPEVYFLFDDVVLTSAGHITYHGPPAGALPFYQQLGFVCPP

Gene3D: G3DSA:3.40.50.300
187-220 no description

DHPILDGLSGVLRPGRPTLLLGPPSSGKSSLLKL

superfamily: SSF52540
187-390 P-loop containing nucleoside triphosphate hydrolases

DHPILDGLSGVLRPGRPTLLLGPPSSGKSSLLKLSDDELLKLMDETYDSGIRTLGAMRAMGIAHTANTPVGDAMLRGVSGGERKRVTTAEMLVGPRRVLLLDEISTGLDSATLYSIADLLCKFCRLFGTTVLVSLLQPPPEVYFLFDDVVLTSAGHITYHGPPAGALPFYQQLGFVCPPRKDVPSFLQEITTASGQQEYASDEL

HMMSmart: SM00382
IPR003593
200-342 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGRPTLLLGPPSSGKSSLLKLSDDELLKLMDETYDSGIRTLGAMRAMGIAHTANTPVGDAMLRGVSGGERKRVTTAEMLVGPRRVLLLDEISTGLDSATLYSIADLLCKFCRLFGTTVLVSLLQPPPEVYFLFDDVVLTSAGH

Seg: seg
205-228 seg

LLLGPPSSGKSSLLKLSDDELLKL

Gene3D: G3DSA:3.40.50.300
241-350 no description

GAMRAMGIAHTANTPVGDAMLRGVSGGERKRVTTAEMLVGPRRVLLLDEISTGLDSATLYSIADLLCKFCRLFGTTVLVSLLQPPPEVYFLFDDVVLTSAGHITYHGPPA

Seg: seg
416-420 seg

AAAAA

Seg: seg
430-446 seg

AEGAEGAATAAATAAAA

Seg: seg
504-516 seg

ALAVVVRRQLLLV

HMMPfam: PF01061
IPR013525
505-683 ABC2_membrane
ABC-2 type transporter

LAVVVRRQLLLVSRDTILIKGRLMQVVVMGLITGSLFFQLGTSVSDARAYFGVSFLAVMFMAMGAMPALPVTLATKGVWEKHRTAYFYPAWCHALGANLAQVPMMVVDSLAYSLILYWMVGYTPVAGQFFAFWLAMFSMSLNSNVLFRLIAYASPDAVSANAFGGFVLLILIVLSGFAI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox