PRGDB00150847 (Cre03.g160900.t1.1)

From PRG Wiki
Jump to: navigation, search
Cre03.g160900.t1.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Chlamydomonas reinhardtii

Comment?

protein tyrosine kinase family protein (best arabidopsis hit)

DNA Sequence

ATGCCCGACCACAAGCTCGCCCAGCGGCTGGCGGTGTTGCCGGCGCCGCTACACCACGGCGCCTCGCCGCTGCACTTCGCAGCGCAGCACACGCATAGCGCGGCCGTGCTGCACCTACTGCTGGAGCGGTTGGGCGCACTGGGCGACACCTCAGGTGACACCTACAACAGCGCCGCCGCGGCCGGCTTGGCGGCACCTGCCGCTGGCGGCGGCTCGGGGTCAGCGGTGGCGGCGGCGGCGGCTGAGCTACTGGATGTGGTGGATGACCGGCAGCAGACGCTGCTGCACTACGCAGCCGCGGCAGACAACGCGCCGGCGCTGGGCCTGCTCCTGCCGCACTTCGGCCGCCGGCTTGGCGTGGACGCGCGCGACGCCGCTGGCGCCACGCCGCTCGCGGCGGCGGCGGCGGCGCGCGCCACGGCGGCGGCAGGTTGCCTGCTGGCGGCTGGCGCCGGCCTGGTGCCTGCGCCGCCGCGCGGCTGGAGCCCGCTTCACTTCGCAGCCATGCACGACAACGATGCAATGCTGCGGCTACTGTTTGAACATGCTAAACGCGCCAGCGGCGGCCGACCGGCGGCGGCGCTGGCGGAGCTTAATGCGCCGGACGCGGAGGCGCGCCGCACGCCGCTGCACGTGGCGGCGGAGTACGGCTGCGCGGCGGCGGCGGCGGCGCTTCTGGATCTGGGCGCGGACCCTACACGGCGTGATCAGTCTGGATCCACGCCGCTGCACCTGGCGGCGGAGCGCGGCTGGGGCGAGGTGGCTGCGGTGCTGGCGCGCGCGACGGCGGCTGCTGCGGCTGCTGCCGGTGCCGCCGCTGGCGCCGCCGCCGCACGCAGCAAGACCGGCGCGGGTGCAGCAAGCACGGCGGCGGCGGCGCGCATCGAGCGGGACTGGGCGGCGGCGGCGACGGCGGACGCGCTTCGGGCCACGCTGTTCAGTGATGCGGGTCTGGCGCCCATGCACCTTGCGGCGGCGGCCAACTCGGTGTCGGCGCTGGGGCGGCTGGCGGAGGCGGGGCACAGCGTGGAGGTGCGGGCGGTGCTGCCGGCCGTGAACGCGCCGGCGGCGGTGCGGCGGCGGTGGCGGGGCTGCTCCAGTTGGACGCCGCTGCACTTCGCGGTGGCGGCGGGCGCTGTCCGCGCCGTGGAGTGCCTCCTGTCGGACCTGGGTGCTGACCCGCACGCCTCCGCGGTGGGCGTGTCGCCGTACGACCTAGTCGTCGCGCTGGCAGGCGACCAACCGCCGCCGCCGTCCGAGGAGGCCGATGACGAGGAGCCCGACGGCTCAGTGGCGGCGGTTGGCGGCGCGTGGTCGCCGTTCGGGCCGCTCAGTGAGGACACTGCGGTGCGGCTGCTGCTGGTGTTTGCAAAGTTCCTGCACCCGGAGGAGGACGTTGTGGGCGCGGCAGTGCAGGCGGCGGGCGCGGCTGGCGCGGCGATGGAGGAGGTGGTGCCGATGGGGTCGGCGGCGGCTGGAGCCGCTGCCACTACGCCCTCCGAGCTTGGCGGCTGGCGCCCTGGTGGTGAGTTGTCGGTGTCGGGTGGCGGTCCGGCAGCGGGGCTGGGGGCCGCAGTTGCAGTGGCAGCGGGAGGGCAGCAGGCGCAGGGGACAAAGGCGGCAACAGCACAGCGACCACAGCCACAACTGCAGCAGCCACAGCAGCTGCCGCAGCAGGACCTAGCAAAGGGCGGTGCAGGACCGTCCAAACCGCCGGCGTCTCGGCCACCTCTACCCCAGACGCATTCACCAGCCGCGTCCGGCGCTGGCCCCAGCCGTCCTCCTCCTCCGCCTCCTTCTTCATCCACCACCGCCACCTACGCCCTCACGTCTGCCGCCTTCGGCAGCAGCGGCAGCGGCCGTGCACCGCAATCGGAAAAGCTAGCAGATCTGCGGCCGCCGCAGCCACAGCCGCCACAGCCGCCGCGGCCTCCGCCATCGCACACGCAGAAGCAGGTGTCGTACATCAGCGACCGGCTTCGGGGCCAGAACCTCGAGCGCCTGGAGGACAAGTCTGACGACCTTCGGCACCAGGCGGGGGTCTTCCAGCGCAAGGGCAGGGCGCTCAAGAAGAAAACGTCGCTGTGGGACGCCTTGAAGGGGCTGGTGGGCGGGACCAAGAAGCCTGCCTTGCCGCCCGCGTCTTCGCCCACCTCTTTGCGGAAGGGTGGAGCCACCTCGTCCATGCCAAGCCCCCTGCCGCCGCGGGGCGGCATGCTCAGCTCCCAGGGCGTGTCGCCGGCGTTCGCCGCCGCCGCGTCGGCAATGGCGAAGGCGGCGGCGGCGCGCGCCGCGGCGCGCGCGGAGCGCGGCGACGATGCTGACGTGGACTCTGACTTCGAGAGGCTGAAGCGCGACAACCGCGAGAGCCTGCAGGAGCTGGAGCGGCAAAAAGAGGGGGAGCAGGAGCAGGAGCGGGGCCCCGCGCTGGGATCGGCGGCAGTGCTTGGGCCGGGGTCAGAAGGGCAGCCGGCGGCGGAGGAGGACTTTGCGATCTCGCAGCAGCAGGAGGGCTGGGGAGGCGGCGGGGCGTCTGGGCCACTGATGCAGTCTGTGGTGCGGCCGCCGGCACCGCAGCCGCGCCCGCCGCCAGCCGCATCGAGTGCGAGCCTGGCGGAGCCGCGGAGCCGACGTGGCAAGGCGCAACACAACGAGTCGCACGTGCACAAGGAGGAGTCGAAGGCGGCAGCGGTGGAGGATGCGGACGAGGAGGACGCGGTGGGGGCGCAGTGGCGGGCGCTGCAGGCTGAGTCGGCTGCGGACTCGAGGGTGGTGTCGCACGCAGCAGCGGCGGCGGCGGCGACGTCAGCGCCAGCGGCGGCGGTGCCACCGCTGGAGCAGCGGGCATCCGCATCTCTCAGGATGCCTGATGACGTGCAGGCGGCTGAGGACGAGGAGGAGGAGGGGGAGGAGGGCGGTGTGGTTGCATCCAAGGGCACATACTATAAGCCACGTAAGATGGCAGCGATGCGAGCCAAGAAGAAAACCGCGCCGCAGCCAGAGATGGCGGCATTGGACGACGAAGCGGCCGTGTCGCTGCCGGCGCCGGAGCCAGTGGAATCGCCGACGGGGCTGCTGGTGGCGCGTGATGAAGCCTCACCGCCGCTGCGCGGCCGCCGCCGCCGCAGCTTCGCCCGTGCGTCGCTCAGTGAAGAGGAGCGCGAGGCGCGCACAGGTGGCCCGCCAGCGTCAATGGGGATCACGGCGGCGGCGGCGGCCACGGCGGCGGCCACGGCGGCGGCGCCGTCGGAGGAAGGCGACGAAAGCAGCCACCGCAGCGGCCGCCGCCTCATGTCCCTGGCGACGTACGACGCGCAAGATGGGCTGGAGGAGCAGAGCTTCGGCACTGCCGGCAGCGCGGCCACTGCCGGTGGGGCTGCCGCCGGCGGCGGTGCCGCGCCTGCAGCCGACGTCTCCGTCGCGGAGCACGAGCAGATTGAGTCCTACTACAGGGAGCGCCTGGACGCAGAGGACGCAAGCGCAAAGGCTTCCGGCCTCACTGGCGACGACGGCAGCAGCAGCGTGGGCGCGCGCTTCCGCAGCGCCGTCACGTCAGTCATGGGCGCCTTCTCCCGCGGCGGCCGCCGCCGCCGCGGCGCCGCCGGCCCGCCGCGCGCCATGAAGTTGATGGCGGCGGCGCCGTCCGATGACGACGACTACGGTGGCATGTGGTCGGGTAGCGCGCCGAAAGCGCGGGACAGGGATCGTGACAGCGGCAGGGACGGGGTGCGGCTCGACGTGCCAGTCGGTTCCGCGGCGCCGCAGCTGGGCAGTGATGACAGTGGCGGCGGCGGAGGGGCAGGCTTGGAAGGGGAGGAGGTGCGCATGTCCACGCAGCGGCTGGCGTCAGGCATGGCGAGTCTGTCGCTGGCGGCAAACATCGGTCGCGAGGAGGAGGAGCAGGAGGAGGAGGGAGGAGGGGAGCCGACGTTTGCCGCCGTGGCGGCGGCATCAGCGTTTGAGCTGGGGATGGCGCGCATATGTTCCGGCATGGGCGATGCGGCTTTGGCAGCAGGAGCAGCGGCAGCGCCGTTGCAGCAACAGCAGCAGCAACAGCAGCAGATTCAACAACAGATGGGGCCATCCTTCAACGCCATCCAACCCACTCCCGCTTTCCGTCCCTCCATCCCCGTCCCCGCCCCCGCTGCGCCGGTCCCCGCGCCCCTGGCGGCGCCGGCCCGCCTGCCTCCGCCCCCTCCGACAGGCGCCGCCCAACACCTCCGTGAGCGCTACGGCGAGGAAGGCGCGCTGGCAGCACCCGCCCCCATCGCGGCTGGCAGCCTCCCGCCGCTGCCGCCGCCGCTGCCCGGCGCCGCCGCCGGCGCCGCCGCCGGCACCGGCGCGTCGCCATTCGCCATGATGGGCGCGAAGCGCGCAGCTGTGCCGCCGTCGCCTTTTGCCATGTCGCTACAGCCGGCGCAGGCTGCAGCGGTCGGCATGCCTGTGCAGCTGCCGCCGTTCCCGGGCTCTACCGCCTCCGCAGCCGCAGCCGCTGCTCCCGCGCCCGCACCAGCTGCAGCCGGATCCGCAGCCGCCGCTTCACCTCACGTAAACCTATTCATGGTGCAGCCGCCGGTGCCGCCACGGGCGGCGGCTCCACTGGATGTTGCTGCTCCTGCAGGCGCCTCGCCCTTCGCCGGCTACGCGGCGCAGCCGGCGGGCGCATCACCCTTCAGCTCGGCTGTGGCGGCGGCGCAGCCGCCGGCGCAGCAGGCTTACGCGCACACGCCGCAGCCGCCGCAGCCACGCCCCACCGGGGGCGCGGCCACTGCCGTGTCGCCTTTGAACAGCCCGTGGGGCGCCTCCACGCTGAACCGCGCCATCCTGCGTGGGCCGCAGCGGGTGGTGGAGATGCTGCTGCAGACGCTGCCGCCGCGGCATGCGGTCGTGCGGCTGGTGCCCAGCGCCGCCGCGCCGGCGCCAGGCGGCGCTCGGGCTGGCGCGGCGGGTGGTGGTGCTGGTGGTGGTGGTGGTGGTGGTGGTGGCGGGCAGCCGCAGCTCCGTGCGGTAGTGGAGTACCTTGGGAAGGAGCTGGAAGGGCTGACGCTGACGGCGAATGCGCCGAGCAACCCCGCCGCGGCGCTGGCACGCCGCCTGGGGCAGCTGTCGCTGGCAGCCGCCGCCACCCCCGGCAGCGCGGGCCCACACGGCTCCGCCCACCATCACACCCCCGCCAGCCCGGGCCCCTTCAGCCCCTACACGCCCAGCCCTTCCGCCGCCGCCGCTCTCAGCGGCTCCTACGGCTCCGGCGCCCTCGGGCTCGGCCTGCCAGGCTCAGGCTCCGCCGGTGGGTACGGCTACTGCCCGAGCCCCGGCGTGTCAACGGGCGGCGTGGGCGCCGCGGCTACCACCCTTGTGTCGGCAGCGACGGCGGCATCGGTCACGCTGCCGTCGGCGGTCCGGGGACTGCTGGAGCTGGCACCTCCAGCGGCGGCGGTGCCGGCGCCACCGGCAGCGGGAGCCGGAGCGGAGGGCGATGAGCAGTGGCCGACGTACGTGACGACGTCGGCGAATCGCGACGTCGCGGCTTGGCTGGCTGTGGAGGGCGTGGCGGAGGCGGCGGCGGGCTGGGCAGCGGTGGAGGTCCAGGCGGCGCCTGTGGCGGCGGCTGCCGGTGGCGGCGGCGCAATGGGTGGTGGCGCCGCCGGCGCCGGGCACCTTTGGCTGGGCGTGGGCCCGCATCCCGACTCGATCGGCTCTGCGTCGGCCGCCGGCTCCCGCCGTGCTAGCGAGACGGCGGGCCACGGTGGCGGCGCGCTCAGCAGCGCCGACTCGGCCGTTGCGTCAACCGGCGGCATCCCCAGCGGCGGCTCTGTACTGAGCGGTTGCAGTACGATAGGCGACGCGCCGCTGGCGGGCGCCCATCTCGTAGATGTACGGGAGGGGCACGTGCTGGCCGCGCCGCCTGCGGGCGCCGCCGCCGGAGGCGGCGGCGGGGCGGGCCGCGGCGGTGGTGGTGGTGGCGGTGGCGGCGGCGGCGGCGGGCAGCGCATTAAGCAGCTGCAGCTGCCGGCGGCGGGCGGGCGCGCGGGGTTGCTGTGGGACATCCTCGGCCGCACCCTCACCGCCGTCGTGAATGGCCGCGCGCCCGTCCTCATCGCGGAGGATCTGCCTCCCCTGCTCCCCACGGCGGCGCCGCCCGGCGCTGGTCCCGCCTCCACCGCCACCTCCGCTGCCGCCCTGTCCGCGCTGGTGCCGCTGGTGGGCGTGCAGCTGCCCGGCGGCTGCCGCCTGACGCTGCGCTGGGGCGGCGGCGGCAGCGGCTTCGCGCTCAGCGGCCGCTGCGGCTGTGTGGACGACATGCTTGCGGCGGCGCAGGAGGCGGCGGCGCGGCGGCGGGCGCCGGGCGGCGCGGCGGCGGCCGGCAGGGACGTGCTGTTTCCGAGCAAGGAGCCCACGATGACCAGCCTCCATTTCGCGGCGTGGAGCGGCAACCTGCGAGTGCTGCCTCAGCTGATCCGTGCCAAGGGCTTCCACCCCGACGAGCCTGACGCGGACGGCTGGACGGCTCTGCACTTCGCAGCCCTGGCGGGGCAGCCTGCTGCGGTGGCTCAGCTGCTGGACCTGGGTGCCACCCCCGACGTGGCCACCTGCCACGGCCGGACGCCAGCCATGATGGCAGCGAGCACGCGCCTGTCTGCGGGCGGCGCCGCCGCGGCCGCCGAGTGCCTGCAGCTGCTGCTGGAGCCCCGCGGTGCCGGAGGAGGAGGCGGCAAGGACCCGGCTGCTGCGGCGGCGGCACTGCGTCAGCAGCTGCATGCGCGCGACGGCCGCGGCCGTACGTTGCTGATGCTGGCGGCAGAGGGCGGCAACCTGCAGGCCGTGGCGTGGCTGCTGGGCAAGGGCCTGGACCCGCTGGCTGTGGACGGCGACGGGCGCAAGGCGCAGTTCTACGCCGCCGCAGCCGACCACACCGAGGTCTACGACCTGCTGGAGGAGGCAGCGGGAGGCGCCATCATCCAGCGGGCGGGCGGCACCGCGCCGCCGCTGCCGGCGGCGGCAGGCACCGCTGCCGCCGCCACGGGCTCGGGCGGCGCCGGCTCAGGCGGCAGCAACGACGTGGCTGCCGGCGGCCGCGACCAGCACCCCCAACACGCCCACCACCTCCAGCAGCACCCGCACCAGCAGGCGGCGGGCGACGCCTTCGCAGTGGTGGGCGGCGGCGTGCTGCGGCCCTGGAACTGGGTGCTTCAGGGCGAGGACGTGACGTGGGGCGCGGTGCTGGGGGACGGCGCCTTTGGGGAGGTGTTCGCGGGCATGTACCGCGGAGTCAAGGTGGCCATCAAGCAGCTGAAGCCACACCTGACGGCGCGCGAGCAGGCCACCCTGGAGAAGGAGCTGTCCATCATGCAGGGCCTGCCTGCCAACGAGCGAGTGGCTGCCTTCATAGGGGTGGTCACCCGCCCCGACGGCCTGCGCGGGCTGGTCATGGCGCGCTACTCCAACAACCTGCACCGCCTGTTCACCACACGTGACCCGCGCCTGAACGCCCGCGCCAGGTTCATCGCCGCCTGGCAGATGGCAGAGGGCCTGCGCTTCCTGCACAACCACCGAGTCATCCACCGCGACCTCAAGCCCGACAACGTGCTGGTCACCGAGAAGCTGGACGTCAAGCTGTGTGACTTCGGTCTAAGCCAGGTGCTGGCGGGTACAGCCAGCGAGGTGGCCAGCACACAGGGCGCCGGCCACGCCTTCTGGATGGCGCCAGAGCTGCTGCGCGGCCAGCCCTACGATTACAAGGTGGACGTGTGGAGCTGGGGTGTGGTGCTTTACCAGCTGGCCACCTGGGTGGACGATGAGGTGTATGCCGGGACACGGCGCGAGACGCTGGTGTACCACTGGACGACACCCGGCGGCAACCCGCCCCGCCTCACCGACGCGCTGCCGCCCGGCCTGCACCCCGAGCTGGTGTCGCTGCTGCATGACTGCCTGGCCGAGGCGCCCTCCGCCCGGCCCGACATGGGGGCGGTGATGAAGCGTCTGGCGGCGCTGCCGGTGCGCGAGTTCACGCGGCCGCCGGCCCCGGTTGAGACCGGTGGCGTGAGCGGTGGTGGGACAGGAGGTAGCAGCGCTCGTGGGGGCTTCTTCGCGTGA


Protein sequences

Name Description Sequence
Cre03.g160900.t1.1 protein tyrosine kinase family protein (best arabidopsis hit)

MPDHKLAQRLAVLPAPLHHGASPLHFAAQHTHSAAVLHLLLERLGALGDTSGDTYNSAAAAGLAAPAAGGGSGSAVAAAAAELLDVVDDRQQTLLHYAAAADNAPALGLLLPHFGRRLGVDARDAAGATPLAAAAAARATAAAGCLLAAGAGLVPAPPRGWSPLHFAAMHDNDAMLRLLFEHAKRASGGRPAAALAELNAPDAEARRTPLHVAAEYGCAAAAAALLDLGADPTRRDQSGSTPLHLAAERGWGEVAAVLARATAAAAAAAGAAAGAAAARSKTGAGAASTAAAARIERDWAAAATADALRATLFSDAGLAPMHLAAAANSVSALGRLAEAGHSVEVRAVLPAVNAPAAVRRRWRGCSSWTPLHFAVAAGAVRAVECLLSDLGADPHASAVGVSPYDLVVALAGDQPPPPSEEADDEEPDGSVAAVGGAWSPFGPLSEDTAVRLLLVFAKFLHPEEDVVGAAVQAAGAAGAAMEEVVPMGSAAAGAAATTPSELGGWRPGGELSVSGGGPAAGLGAAVAVAAGGQQAQGTKAATAQRPQPQLQQPQQLPQQDLAKGGAGPSKPPASRPPLPQTHSPAASGAGPSRPPPPPPSSSTTATYALTSAAFGSSGSGRAPQSEKLADLRPPQPQPPQPPRPPPSHTQKQVSYISDRLRGQNLERLEDKSDDLRHQAGVFQRKGRALKKKTSLWDALKGLVGGTKKPALPPASSPTSLRKGGATSSMPSPLPPRGGMLSSQGVSPAFAAAASAMAKAAAARAAARAERGDDADVDSDFERLKRDNRESLQELERQKEGEQEQERGPALGSAAVLGPGSEGQPAAEEDFAISQQQEGWGGGGASGPLMQSVVRPPAPQPRPPPAASSASLAEPRSRRGKAQHNESHVHKEESKAAAVEDADEEDAVGAQWRALQAESAADSRVVSHAAAAAAATSAPAAAVPPLEQRASASLRMPDDVQAAEDEEEEGEEGGVVASKGTYYKPRKMAAMRAKKKTAPQPEMAALDDEAAVSLPAPEPVESPTGLLVARDEASPPLRGRRRRSFARASLSEEEREARTGGPPASMGITAAAAATAAATAAAPSEEGDESSHRSGRRLMSLATYDAQDGLEEQSFGTAGSAATAGGAAAGGGAAPAADVSVAEHEQIESYYRERLDAEDASAKASGLTGDDGSSSVGARFRSAVTSVMGAFSRGGRRRRGAAGPPRAMKLMAAAPSDDDDYGGMWSGSAPKARDRDRDSGRDGVRLDVPVGSAAPQLGSDDSGGGGGAGLEGEEVRMSTQRLASGMASLSLAANIGREEEEQEEEGGGEPTFAAVAAASAFELGMARICSGMGDAALAAGAAAAPLQQQQQQQQQIQQQMGPSFNAIQPTPAFRPSIPVPAPAAPVPAPLAAPARLPPPPPTGAAQHLRERYGEEGALAAPAPIAAGSLPPLPPPLPGAAAGAAAGTGASPFAMMGAKRAAVPPSPFAMSLQPAQAAAVGMPVQLPPFPGSTASAAAAAAPAPAPAAAGSAAAASPHVNLFMVQPPVPPRAAAPLDVAAPAGASPFAGYAAQPAGASPFSSAVAAAQPPAQQAYAHTPQPPQPRPTGGAATAVSPLNSPWGASTLNRAILRGPQRVVEMLLQTLPPRHAVVRLVPSAAAPAPGGARAGAAGGGAGGGGGGGGGGQPQLRAVVEYLGKELEGLTLTANAPSNPAAALARRLGQLSLAAAATPGSAGPHGSAHHHTPASPGPFSPYTPSPSAAAALSGSYGSGALGLGLPGSGSAGGYGYCPSPGVSTGGVGAAATTLVSAATAASVTLPSAVRGLLELAPPAAAVPAPPAAGAGAEGDEQWPTYVTTSANRDVAAWLAVEGVAEAAAGWAAVEVQAAPVAAAAGGGGAMGGGAAGAGHLWLGVGPHPDSIGSASAAGSRRASETAGHGGGALSSADSAVASTGGIPSGGSVLSGCSTIGDAPLAGAHLVDVREGHVLAAPPAGAAAGGGGGAGRGGGGGGGGGGGGGQRIKQLQLPAAGGRAGLLWDILGRTLTAVVNGRAPVLIAEDLPPLLPTAAPPGAGPASTATSAAALSALVPLVGVQLPGGCRLTLRWGGGGSGFALSGRCGCVDDMLAAAQEAAARRRAPGGAAAAGRDVLFPSKEPTMTSLHFAAWSGNLRVLPQLIRAKGFHPDEPDADGWTALHFAALAGQPAAVAQLLDLGATPDVATCHGRTPAMMAASTRLSAGGAAAAAECLQLLLEPRGAGGGGGKDPAAAAAALRQQLHARDGRGRTLLMLAAEGGNLQAVAWLLGKGLDPLAVDGDGRKAQFYAAAADHTEVYDLLEEAAGGAIIQRAGGTAPPLPAAAGTAAAATGSGGAGSGGSNDVAAGGRDQHPQHAHHLQQHPHQQAAGDAFAVVGGGVLRPWNWVLQGEDVTWGAVLGDGAFGEVFAGMYRGVKVAIKQLKPHLTAREQATLEKELSIMQGLPANERVAAFIGVVTRPDGLRGLVMARYSNNLHRLFTTRDPRLNARARFIAAWQMAEGLRFLHNHRVIHRDLKPDNVLVTEKLDVKLCDFGLSQVLAGTASEVASTQGAGHAFWMAPELLRGQPYDYKVDVWSWGVVLYQLATWVDDEVYAGTRRETLVYHWTTPGGNPPRLTDALPPGLHPELVSLLHDCLAEAPSARPDMGAVMKRLAALPVREFTRPPAPVETGGVSGGGTGGSSARGGFFA*

Domains

Domain Start-End Description Sequence

superfamily: SSF48403
IPR020683
18-260 Ankyrin repeat
Ankyrin repeat-containing domain

HHGASPLHFAAQHTHSAAVLHLLLERLGALGDTSGDTYNSAAAAGLAAPAAGGGSGSAVAAAAAELLDVVDDRQQTLLHYAAAADNAPALGLLLPHFGRRLGVDARDAAGATPLAAAAAARATAAAGCLLAAGAGLVPAPPRGWSPLHFAAMHDNDAMLRLLFEHAKRASGGRPAAALAELNAPDAEARRTPLHVAAEYGCAAAAAALLDLGADPTRRDQSGSTPLHLAAERGWGEVAAVLAR

HMMSmart: SM00248
IPR002110
19-49 ankyrin repeats
Ankyrin repeat

HGASPLHFAAQHTHSAAVLHLLLERLGALGD

ProfileScan: PS50297
IPR020683
19-399 ANK_REP_REGION
Ankyrin repeat-containing domain

HGASPLHFAAQHTHSAAVLHLLLERLGALGDTSGDTYNSAAAAGLAAPAAGGGSGSAVAAAAAELLDVVDDRQQTLLHYAAAADNAPALGLLLPHFGRRLGVDARDAAGATPLAAAAAARATAAAGCLLAAGAGLVPAPPRGWSPLHFAAMHDNDAMLRLLFEHAKRASGGRPAAALAELNAPDAEARRTPLHVAAEYGCAAAAAALLDLGADPTRRDQSGSTPLHLAAERGWGEVAAVLARATAAAAAAAGAAAGAAAARSKTGAGAASTAAAARIERDWAAAATADALRATLFSDAGLAPMHLAAAANSVSALGRLAEAGHSVEVRAVLPAVNAPAAVRRRWRGCSSWTPLHFAVAAGAVRAVECLLSDLGADPHASAV

ProfileScan: PS50088
IPR002110
19-43 ANK_REPEAT
Ankyrin repeat

HGASPLHFAAQHTHSAAVLHLLLER

Seg: seg
34-47 seg

AAVLHLLLERLGAL

Seg: seg
57-81 seg

SAAAAGLAAPAAGGGSGSAVAAAAA

Gene3D: G3DSA:1.25.40.20
IPR020683
85-266 no description
Ankyrin repeat-containing domain

DVVDDRQQTLLHYAAAADNAPALGLLLPHFGRRLGVDARDAAGATPLAAAAAARATAAAGCLLAAGAGLVPAPPRGWSPLHFAAMHDNDAMLRLLFEHAKRASGGRPAAALAELNAPDAEARRTPLHVAAEYGCAAAAAALLDLGADPTRRDQSGSTPLHLAAERGWGEVAAVLARATAAAA

HMMSmart: SM00248
IPR002110
90-120 ankyrin repeats
Ankyrin repeat

RQQTLLHYAAAADNAPALGLLLPHFGRRLGV

Seg: seg
94-111 seg

LLHYAAAADNAPALGLLL

Seg: seg
121-158 seg

DARDAAGATPLAAAAAARATAAAGCLLAAGAGLVPAPP

HMMSmart: SM00248
IPR002110
126-156 ankyrin repeats
Ankyrin repeat

AGATPLAAAAAARATAAAGCLLAAGAGLVPA

HMMSmart: SM00248
IPR002110
159-188 ankyrin repeats
Ankyrin repeat

RGWSPLHFAAMHDNDAMLRLLFEHAKRASG

ProfileScan: PS50088
IPR002110
159-182 ANK_REPEAT
Ankyrin repeat

RGWSPLHFAAMHDNDAMLRLLFEH

HMMPfam: PF12796
IPR020683
164-262 Ank_2,Ankyrin repeats (3 copies)
Ankyrin repeat-containing domain

LHFAAMHDNDAMLRLLFEHAKRASGGRPAAALAELNAPDAEARRTPLHVAAEYGCAAAAAALLDLGADPTRRDQSGSTPLHLAAERGWGEVAAVLARAT

Seg: seg
191-205 seg

PAAALAELNAPDAEA

superfamily: SSF48403
IPR020683
196-393 Ankyrin repeat
Ankyrin repeat-containing domain

AELNAPDAEARRTPLHVAAEYGCAAAAAALLDLGADPTRRDQSGSTPLHLAAERGWGEVAAVLARATAAAAAAAGAAAGAAAARSKTGAGAASTAAAARIERDWAAAATADALRATLFSDAGLAPMHLAAAANSVSALGRLAEAGHSVEVRAVLPAVNAPAAVRRRWRGCSSWTPLHFAVAAGAVRAVECLLSDLGAD

ProfileScan: PS50088
IPR002110
205-237 ANK_REPEAT
Ankyrin repeat

ARRTPLHVAAEYGCAAAAAALLDLGADPTRRDQ

HMMSmart: SM00248
IPR002110
205-234 ankyrin repeats
Ankyrin repeat

ARRTPLHVAAEYGCAAAAAALLDLGADPTR

Seg: seg
213-231 seg

AAEYGCAAAAAALLDLGAD

HMMSmart: SM00248
IPR002110
238-267 ankyrin repeats
Ankyrin repeat

SGSTPLHLAAERGWGEVAAVLARATAAAAA

ProfileScan: PS50088
IPR002110
238-270 ANK_REPEAT
Ankyrin repeat

SGSTPLHLAAERGWGEVAAVLARATAAAAAAAG

Seg: seg
255-311 seg

AAVLARATAAAAAAAGAAAGAAAARSKTGAGAASTAAAARIERDWAAAATADALRAT

HMMSmart: SM00248
IPR002110
316-345 ankyrin repeats
Ankyrin repeat

AGLAPMHLAAAANSVSALGRLAEAGHSVEV

Seg: seg
316-327 seg

AGLAPMHLAAAA

Seg: seg
345-363 seg

VRAVLPAVNAPAAVRRRWR

HMMSmart: SM00248
IPR002110
366-396 ankyrin repeats
Ankyrin repeat

SSWTPLHFAVAAGAVRAVECLLSDLGADPHA

HMMPfam: PF00023
IPR002110
368-396 Ank
Ankyrin repeat

WTPLHFAVAAGAVRAVECLLSDLGADPHA

Seg: seg
413-428 seg

DQPPPPSEEADDEEPD

Seg: seg
466-480 seg

VVGAAVQAAGAAGAA

Seg: seg
490-496 seg

AAAGAAA

Seg: seg
515-544 seg

GGGPAAGLGAAVAVAAGGQQAQGTKAATAQ

Seg: seg
546-559 seg

PQPQLQQPQQLPQQ

Seg: seg
561-579 seg

LAKGGAGPSKPPASRPPLP

Seg: seg
583-613 seg

SPAASGAGPSRPPPPPPSSSTTATYALTSAA

Seg: seg
615-620 seg

GSSGSG

Seg: seg
632-646 seg

RPPQPQPPQPPRPPP

Gene3D: G3DSA:1.20.5.110
661-692 no description

RGQNLERLEDKSDDLRHQAGVFQRKGRALKKK

Coil: coil
665-686 coiled-coil

LERLEDKSDDLRHQAGVFQRKG

Seg: seg
706-720 seg

TKKPALPPASSPTSL

Seg: seg
748-775 seg

AFAAAASAMAKAAAARAAARAERGDDAD

Coil: coil
780-805 coiled-coil

FERLKRDNRESLQELERQKEGEQEQE

Seg: seg
791-807 seg

LQELERQKEGEQEQERG

Seg: seg
838-846 seg

GWGGGGASG

Seg: seg
854-878 seg

RPPAPQPRPPPAASSASLAEPRSRR

Seg: seg
890-907 seg

KEESKAAAVEDADEEDAV

Seg: seg
919-944 seg

AADSRVVSHAAAAAAATSAPAAAVPP

Seg: seg
957-976 seg

DDVQAAEDEEEEGEEGGVVA

Seg: seg
983-998 seg

KPRKMAAMRAKKKTAP

Seg: seg
1031-1057 seg

EASPPLRGRRRRSFARASLSEEEREAR

Seg: seg
1068-1081 seg

TAAAAATAAATAAA

Seg: seg
1115-1136 seg

GTAGSAATAGGAAAGGGAAPAA

Seg: seg
1192-1206 seg

RGGRRRRGAAGPPRA

Seg: seg
1232-1247 seg

RDRDRDSGRDGVRLDV

Seg: seg
1256-1272 seg

LGSDDSGGGGGAGLEGE

Seg: seg
1281-1292 seg

LASGMASLSLAA

Seg: seg
1295-1308 seg

GREEEEQEEEGGGE

Seg: seg
1312-1319 seg

AAVAAASA

Seg: seg
1334-1358 seg

AALAAGAAAAPLQQQQQQQQQIQQQ

Seg: seg
1377-1400 seg

PVPAPAAPVPAPLAAPARLPPPPP

Seg: seg
1415-1450 seg

GALAAPAPIAAGSLPPLPPPLPGAAAGAAAGTGASP

Seg: seg
1485-1515 seg

PPFPGSTASAAAAAAPAPAPAAAGSAAAASP

Seg: seg
1522-1542 seg

VQPPVPPRAAAPLDVAAPAGA

Seg: seg
1552-1591 seg

PAGASPFSSAVAAAQPPAQQAYAHTPQPPQPRPTGGAATA

Seg: seg
1636-1663 seg

AAAPAPGGARAGAAGGGAGGGGGGGGGG

Seg: seg
1682-1698 seg

TLTANAPSNPAAALARR

Seg: seg
1710-1727 seg

PGSAGPHGSAHHHTPASP

Seg: seg
1731-1800 seg

SPYTPSPSAAAALSGSYGSGALGLGLPGSGSAGGYGYCPSPGVSTGGVGAAATTLVSAATAASVTLPSAV

Seg: seg
1807-1823 seg

APPAAAVPAPPAAGAGA

Seg: seg
1841-1885 seg

VAAWLAVEGVAEAAAGWAAVEVQAAPVAAAAGGGGAMGGGAAGAG

Seg: seg
1899-1910 seg

GSASAAGSRRAS

Seg: seg
1966-1995 seg

AAPPAGAAAGGGGGAGRGGGGGGGGGGGGG

Seg: seg
2037-2070 seg

LPPLLPTAAPPGAGPASTATSAAALSALVPLVGV

Seg: seg
2083-2096 seg

GGGGSGFALSGRCG

Seg: seg
2103-2123 seg

AAAQEAAARRRAPGGAAAAGR

Gene3D: G3DSA:1.25.40.20
IPR020683
2126-2315 no description
Ankyrin repeat-containing domain

LFPSKEPTMTSLHFAAWSGNLRVLPQLIRAKGFHPDEPDADGWTALHFAALAGQPAAVAQLLDLGATPDVATCHGRTPAMMAASTRLSAGGAAAAAECLQLLLEPRGAGGGGGKDPAAAAAALRQQLHARDGRGRTLLMLAAEGGNLQAVAWLLGKGLDPLAVDGDGRKAQFYAAAADHTEVYDLLEEAA

ProfileScan: PS50297
IPR020683
2132-2311 ANK_REP_REGION
Ankyrin repeat-containing domain

PTMTSLHFAAWSGNLRVLPQLIRAKGFHPDEPDADGWTALHFAALAGQPAAVAQLLDLGATPDVATCHGRTPAMMAASTRLSAGGAAAAAECLQLLLEPRGAGGGGGKDPAAAAAALRQQLHARDGRGRTLLMLAAEGGNLQAVAWLLGKGLDPLAVDGDGRKAQFYAAAADHTEVYDLL

HMMSmart: SM00248
IPR002110
2132-2162 ankyrin repeats
Ankyrin repeat

PTMTSLHFAAWSGNLRVLPQLIRAKGFHPDE

superfamily: SSF48403
IPR020683
2134-2312 Ankyrin repeat
Ankyrin repeat-containing domain

MTSLHFAAWSGNLRVLPQLIRAKGFHPDEPDADGWTALHFAALAGQPAAVAQLLDLGATPDVATCHGRTPAMMAASTRLSAGGAAAAAECLQLLLEPRGAGGGGGKDPAAAAAALRQQLHARDGRGRTLLMLAAEGGNLQAVAWLLGKGLDPLAVDGDGRKAQFYAAAADHTEVYDLLE

HMMPfam: PF12796
IPR020683
2137-2229 Ank_2,Ankyrin repeats (3 copies)
Ankyrin repeat-containing domain

LHFAAWSGNLRVLPQLIRAKGFHPDEPDADGWTALHFAALAGQPAAVAQLLDLGATPDVATCHGRTPAMMAASTRLSAGGAAAAAECLQLLLE

ProfileScan: PS50088
IPR002110
2166-2198 ANK_REPEAT
Ankyrin repeat

DGWTALHFAALAGQPAAVAQLLDLGATPDVATC

HMMSmart: SM00248
IPR002110
2166-2195 ankyrin repeats
Ankyrin repeat

DGWTALHFAALAGQPAAVAQLLDLGATPDV

Seg: seg
2174-2187 seg

AALAGQPAAVAQLL

HMMSmart: SM00248
IPR002110
2199-2243 ankyrin repeats
Ankyrin repeat

HGRTPAMMAASTRLSAGGAAAAAECLQLLLEPRGAGGGGGKDPAA

Seg: seg
2207-2229 seg

AASTRLSAGGAAAAAECLQLLLE

Seg: seg
2232-2247 seg

GAGGGGGKDPAAAAAA

HMMPfam: PF13857
2251-2294 Ank_5,Ankyrin repeats (many copies)

QLHARDGRGRTLLMLAAEGGNLQAVAWLLGKGLDPLAVDGDGRK

ProfileScan: PS50088
IPR002110
2258-2290 ANK_REPEAT
Ankyrin repeat

RGRTLLMLAAEGGNLQAVAWLLGKGLDPLAVDG

HMMSmart: SM00248
IPR002110
2258-2287 ankyrin repeats
Ankyrin repeat

RGRTLLMLAAEGGNLQAVAWLLGKGLDPLA

Seg: seg
2314-2358 seg

AAGGAIIQRAGGTAPPLPAAAGTAAAATGSGGAGSGGSNDVAAGG

Seg: seg
2361-2389 seg

QHPQHAHHLQQHPHQQAAGDAFAVVGGGV

superfamily: SSF56112
IPR011009
2364-2661 Protein kinase-like (PK-like)
Protein kinase-like domain

QHAHHLQQHPHQQAAGDAFAVVGGGVLRPWNWVLQGEDVTWGAVLGDGAFGEVFAGMYRGVKVAIKQLKPHLTAREQATLEKELSIMQGLPANERVAAFIGVVTRPDGLRGLVMARYSNNLHRLFTTRDPRLNARARFIAAWQMAEGLRFLHNHRVIHRDLKPDNVLVTEKLDVKLCDFGLSQVLAGTASEVASTQGAGHAFWMAPELLRGQPYDYKVDVWSWGVVLYQLATWVDDEVYAGTRRETLVYHWTTPGGNPPRLTDALPPGLHPELVSLLHDCLAEAPSARPDMGAVMKRL

Gene3D: G3DSA:3.30.200.20
2366-2510 no description

AHHLQQHPHQQAAGDAFAVVGGGVLRPWNWVLQGEDVTWGAVLGDGAFGEVFAGMYRGVKVAIKQLKPHLTAREQATLEKELSIMQGLPANERVAAFIGVVTRPDGLRGLVMARYSNNLHRLFTTRDPRLNARARFIAAWQMAEG

HMMPanther: PTHR23257
2395-2692 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

WVLQGEDVTWGAVLGDGAFGEVFAGMYRGVKVAIKQLKPHLTAREQATLEKELSIMQGLPANERVAAFIGVVTRPDGLRGLVMARYSNNLHRLFTTRDPRLNARARFIAAWQMAEGLRFLHNHRVIHRDLKPDNVLVTEKLDVKLCDFGLSQVLAGTASEVASTQGAGHAFWMAPELLRGQPYDYKVDVWSWGVVLYQLATWVDDEVYAGTRRETLVYHWTTPGGNPPRLTDALPPGLHPELVSLLHDCLAEAPSARPDMGAVMKRLAALPVREFTRPPAPVETGGVSGGGTGGSSAR

HMMSmart: SM00219
IPR020635
2402-2661 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VTWGAVLGDGAFGEVFAGMYRGVKVAIKQLKPHLTAREQATLEKELSIMQGLPANERVAAFIGVVTRPDGLRGLVMARYSNNLHRLFTTRDPRLNARARFIAAWQMAEGLRFLHNHRVIHRDLKPDNVLVTEKLDVKLCDFGLSQVLAGTASEVASTQGAGHAFWMAPELLRGQPYDYKVDVWSWGVVLYQLATWVDDEVYAGTRRETLVYHWTTPGGNPPRLTDALPPGLHPELVSLLHDCLAEAPSARPDMGAVMKRL

ProfileScan: PS50011
IPR000719
2402-2670 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

VTWGAVLGDGAFGEVFAGMYRGVKVAIKQLKPHLTAREQATLEKELSIMQGLPANERVAAFIGVVTRPDGLRGLVMARYSNNLHRLFTTRDPRLNARARFIAAWQMAEGLRFLHNHRVIHRDLKPDNVLVTEKLDVKLCDFGLSQVLAGTASEVASTQGAGHAFWMAPELLRGQPYDYKVDVWSWGVVLYQLATWVDDEVYAGTRRETLVYHWTTPGGNPPRLTDALPPGLHPELVSLLHDCLAEAPSARPDMGAVMKRLAALPVREFT

HMMSmart: SM00220
IPR002290
2402-2664 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VTWGAVLGDGAFGEVFAGMYRGVKVAIKQLKPHLTAREQATLEKELSIMQGLPANERVAAFIGVVTRPDGLRGLVMARYSNNLHRLFTTRDPRLNARARFIAAWQMAEGLRFLHNHRVIHRDLKPDNVLVTEKLDVKLCDFGLSQVLAGTASEVASTQGAGHAFWMAPELLRGQPYDYKVDVWSWGVVLYQLATWVDDEVYAGTRRETLVYHWTTPGGNPPRLTDALPPGLHPELVSLLHDCLAEAPSARPDMGAVMKRLAAL

HMMPfam: PF07714
IPR001245
2404-2661 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

WGAVLGDGAFGEVFAGMYRGVKVAIKQLKPHLTAREQATLEKELSIMQGLPANERVAAFIGVVTRPDGLRGLVMARYSNNLHRLFTTRDPRLNARARFIAAWQMAEGLRFLHNHRVIHRDLKPDNVLVTEKLDVKLCDFGLSQVLAGTASEVASTQGAGHAFWMAPELLRGQPYDYKVDVWSWGVVLYQLATWVDDEVYAGTRRETLVYHWTTPGGNPPRLTDALPPGLHPELVSLLHDCLAEAPSARPDMGAVMKRL

PatternScan: PS00107
IPR017441
2408-2429 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGDGAFGEVFAGMYRGVKVAIK

Gene3D: G3DSA:1.10.510.10
2511-2661 no description

LRFLHNHRVIHRDLKPDNVLVTEKLDVKLCDFGLSQVLAGTASEVASTQGAGHAFWMAPELLRGQPYDYKVDVWSWGVVLYQLATWVDDEVYAGTRRETLVYHWTTPGGNPPRLTDALPPGLHPELVSLLHDCLAEAPSARPDMGAVMKRL

PatternScan: PS00108
IPR008271
2519-2531 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKPDNVLV

Seg: seg
2679-2694 seg

GGVSGGGTGGSSARGG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox