PRGDB00150848 (Cre03.g166750.t1.1)

From PRG Wiki
Jump to: navigation, search
Cre03.g166750.t1.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Chlamydomonas reinhardtii

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGACGTTGGAACAGCTAGAAGATAGAAACAGCTCGCACGGCGGCACCTGCGCTGGGAGCAACTCCTGTCTAACACGAGGACGGCGGAGCTCCGCGACGGAGACGCTAGCTCTGGAGGAGCTGCCCTCCGTGGGCCACCTCGCGGAGGCCGGCTGGACGCGCGCGCTCGCGGACAACATCAAGAGCGTGGCTGCGGTGACCGGGGTCATGGGCGGCGGCAGCATGCCCAACAGCCCTCATGGCAGCGTGCTGGGCGCGCGCGGCAGCCTCACGGGTGTCAAGTACGGTACAGCGCTGGGCGTGGGGGCGGCGCCTAACGCCGTGATGGCGGGGTTCCGGCCCAGCGGCTCAGGACTGAAAAGCAGCAGTGGCGCAGGCGGCCTGCCGGGCGGGCCGGTGGGCTCGGCCACGCTTGTCACGGAGCTTGAGGAGTTTGATGGCGGCGACGACGTAGAAGCGGCCCTCAACGTGGTGCCGGATGCGCTCATGCAGCAAGCCGTCAAGGCGGGGGTGAACTTGCAGGTGTGCATGGACACGGACGTCACACTGAGCTCGGAACAGCTGGGGCGTGGCGTGTCGGGCACGGTGGTGAAGGGCACCTACCGGGGACAGCCCGCCGCAATCAAGATGCTGCCGCCGGACTTGCTGTTCGGCAACCGCAGCCTGGAGCTGCACACCTTCGTGCAGGAGATGGTGGTGCTGTGCGGTGTGCGCCACCCCAACATCGTGAACCTGCTGGGCGGCTCGCTGCAGCCACCAAACGTGTTCATCGTGGAGGAGCTGTGTGTGGGCTCGCTGGAGGCCCGGATACACGGGGGCCCGGGCAAGAACGCCGCCGCGCCCAAGGCCCTGAGCGCCTATGAGCAGCTGCGGATAGCGGTGGATGTGGCCACGGGTCTGCAGTACCTGCATGAGCGCACGCCTGCCATCGTACACCGCGACCTCAAGCCCGCAAACATCCTCATTGACCCCAACGGCACTGCCAAGATCTCCGACTTTGGACTGGCGCGCGTGAAGACACACGCCGTCATCAACACCAAAGCGCCGGACGTGGGGTCCATCGGTTACATGGCTCCTGAGTGCTTCACCAATGAGGACGGCCAGCTGACGGACAAGTGCGACACGTGGTCTCTGGGCGTGACGATATGGGAGATGGTGACCCGCAAGCGGCCCTGGGCCTCCTGCAACATGGCCGAGTACTACCGTGAGGTGGTTATTAGGAAGAGCCGGCTGCCCATACCGCAGGACGACAACGTGTGCCCCATGGCGCTGCGTCGCCTCATCAGCAGCTGCTGGTGCGACGACCCCGAGGACCGCCCCTCCTGCGGCCACATCGTGGAGGAGCTCAGCCGCCTGCTCAAGTACGCGCCGCGGCCGCTGGTGGAGGAGAACTTGTGA


Protein sequences

Name Description Sequence
Cre03.g166750.t1.1 Protein kinase superfamily protein (best arabidopsis hit)

MTLEQLEDRNSSHGGTCAGSNSCLTRGRRSSATETLALEELPSVGHLAEAGWTRALADNIKSVAAVTGVMGGGSMPNSPHGSVLGARGSLTGVKYGTALGVGAAPNAVMAGFRPSGSGLKSSSGAGGLPGGPVGSATLVTELEEFDGGDDVEAALNVVPDALMQQAVKAGVNLQVCMDTDVTLSSEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELCVGSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEELSRLLKYAPRPLVEENL*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23257
24-453 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

LTRGRRSSATETLALEELPSVGHLAEAGWTRALADNIKSVAAVTGVMGGGSMPNSPHGSVLGARGSLTGVKYGTALGVGAAPNAVMAGFRPSGSGLKSSSGAGGLPGGPVGSATLVTELEEFDGGDDVEAALNVVPDALMQQAVKAGVNLQVCMDTDVTLSSEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELCVGSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEELSRLL

HMMPanther: PTHR23257:SF327
24-453 PREDICTED PROTEIN (FRAGMENT)

LTRGRRSSATETLALEELPSVGHLAEAGWTRALADNIKSVAAVTGVMGGGSMPNSPHGSVLGARGSLTGVKYGTALGVGAAPNAVMAGFRPSGSGLKSSSGAGGLPGGPVGSATLVTELEEFDGGDDVEAALNVVPDALMQQAVKAGVNLQVCMDTDVTLSSEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELCVGSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEELSRLL

Seg: seg
115-136 seg

SGSGLKSSSGAGGLPGGPVGSA

superfamily: SSF56112
IPR011009
152-457 Protein kinase-like (PK-like)
Protein kinase-like domain

EAALNVVPDALMQQAVKAGVNLQVCMDTDVTLSSEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELCVGSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEELSRLLKYAP

ProfileScan: PS50011
IPR000719
182-453 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

TLSSEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELCVGSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEELSRLL

HMMSmart: SM00219
IPR020635
182-449 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

TLSSEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELCVGSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEEL

HMMSmart: SM00220
IPR002290
182-456 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

TLSSEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELCVGSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEELSRLLKYA

Gene3D: G3DSA:3.30.200.20
185-262 no description

SEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELC

HMMPfam: PF07714
IPR001245
185-449 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SEQLGRGVSGTVVKGTYRGQPAAIKMLPPDLLFGNRSLELHTFVQEMVVLCGVRHPNIVNLLGGSLQPPNVFIVEELCVGSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEEL

PatternScan: PS00107
IPR017441
188-209 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGVSGTVVKGTYRGQPAAIK

Gene3D: G3DSA:1.10.510.10
264-449 no description

GSLEARIHGGPGKNAAAPKALSAYEQLRIAVDVATGLQYLHERTPAIVHRDLKPANILIDPNGTAKISDFGLARVKTHAVINTKAPDVGSIGYMAPECFTNEDGQLTDKCDTWSLGVTIWEMVTRKRPWASCNMAEYYREVVIRKSRLPIPQDDNVCPMALRRLISSCWCDDPEDRPSCGHIVEEL

Seg: seg
272-283 seg

GGPGKNAAAPKA

FPrintScan: PR00109
IPR001245
304-322 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

HERTPAIVHRDLKPANILI

PatternScan: PS00108
IPR008271
310-322 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKPANILI

FPrintScan: PR00109
IPR001245
373-395 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CDTWSLGVTIWEMVTRKRPWASC

FPrintScan: PR00109
IPR001245
420-442 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CPMALRRLISSCWCDDPEDRPSC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox