PRGDB00150852 (Cucsa.004440.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.004440.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

Malectin/receptor-like protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGAGATTAAAGAAAAGAAGAGAACTTCGACTATCTCCTCTCCATTAATGTCATCTTCTTCGATGGCTATCCTCCTGGTTTTTCTCTGTTTCATTTTTAACTGTCCAAACATCGCATTTGCTACCGGCCCCGGCGCTTCCTTCATTCCCAAAGATAATTTTCTCATTGACTGTGGTGCCAACAAGGAAGTTGGTGCACTCCCTGATGGGAGAGTTTTCAAAACTGATGAGCAATCCAAGCAATACTTAGATGCCAAGGATGACATTATAGCAACCGCTACGCCGGAGATGAAGGCACCGTCGCCAGTCGATTTGACAGCCAGAGTCTTCCTCCAAGAAGCTACTTACATTTTTCAAATGGCAGAGCCTGGATGGCATTGGCTACGCCTACATTTCCTTCCTGTTAAAAGCAATGACTTTGATCTCTTGCAAGCCAAATTTTCAGTAGCTACTGAAAATTATGTGTTGCTTCATAGCTTTAACATCAACAATGAATCCACATTTGTTCTCAAGGAGTTTCTCCTCAATATCACTGAACCAAAACTCTCAATCAAGTTCTTGCCTATGAGGAATTCAGCTGCTTTCATCAACGCCATCGAGGTCGTCTCGGCTCCTGTGGACTTGATTGCCGATTCCAACGTGGAGTTGTCTCCAGTTGGAACTATTGAGGGCCTGTCAAAATATGCATTTCAGACACTGTATAGGTTAAACATGGGAGGTCCTATAATTACTCCAAGAAATGACACTCTTGGGAGAACATGGGAGACAGATGAAGTTTATAGGACACCGAAAGCTGCTGGTAGTAGTGTGGTTGTTCAGACTAATAGCATCAAATACCAAGGAGGATTGAAAGAAACAGGCATGTTAATTGCTCCTCCAAGTGTGTATGCAAGTGCAGTTCAAATGGGAGATGCTCAAGTTAGTGTACCAAATTTCAATATCACGTGGAAATTTGAAGCAGATCCCTCATTTGGGTATCTAGTTCGCTTCCATTTTTGTGATATTGTCAGCAAAGTACTCAATGATATCTATTTCAATGTTTATGTAAATGGGAAAGCTGCTATAACCAACTTGGATTTGTCACACAAGCTAGGAAGTTTGGCAACTGCATATTACAAGGATGTTGTGGTTAATGCTTCCTTGATTGTAGATGGACTGACAGTTCAAATTAGTCCGGCTAATGTCGATACCGGTGATTCGAATGCCATTCTAAATGGTATAGAGGTATTGAAAATAAGCAACTCTGTTAATAGTTTGGATGGAGAGTTTGGAGTGGATGGTAAGTCTGCAAATGGATCTAACCGTGGGACAGTTGCTGCCGTTGGGTTTGCAATGATGTTTGGAGCGTTTGTTGGGCTCGGCGCGATGGTGATGAAATGGCATAAAAGGCCTCAGGATTGGCAGAAGAGGAACAGTTTCTCTTCTTGGTTGCTTCCTGTACATGCTGGTGATTCAAGCTTTATGACAAGCAAGACTTCATATGGATCACATAAGACCAACATTTATTCCTCTACTTTAGGCCTTGGTAGGTTCTTTACTTTGGCAGAACTTCAAGAAGCCACCAAGAACTTTGATCCCAATTCAATAATTGGTGTTGGTGGGTTTGGAAATGTGTACCTTGGAGTGATTGATGAAGGGACTAAAGTAGCAGTTAAGAGAGGAAATCCACAATCTGAACAAGGCATAACAGAATTCCAAACAGAAATTCAAATGCTTTCAAAACTTAGACATAGGCATTTGGTTTCTTTGATTGGGTACTGTGATGAAAATGCTGAAATGATCTTGGTATATGAGTTCATGTCAAATGGTCCATTCAGAGATCACTTATATGGAAAGGACATATCTCCATTGTCATGGAAGCAAAGGCTGGAGATTTGTATCGGGGCAGCTCGAGGTCTCCATTACCTGCACACAGGAACAGCACAAGGAATCATTCACCGTGACGTCAAAACAACCAACATTTTACTCGACGAAAACTTCACCGCGAAAGTTGCCGATTTCGGATTGTCGAAGGATGCTCCAATGGGGCAAGGACATGTCAGTACAGCAGTGAAAGGAAGTTTTGGATATTTGGATCCAGAGTACTTTAGGAGACAACAGTTAACAGAAAAATCAGATGTTTATTCCTTTGGAGTTGTTCTGCTTGAGGCTTTGTGTGCAAGGCCAGCAATCAACCCATCTTTGACAAGAGAACAAGTGAACTTAGCTGATTGGGCAATGCAGTGTAAGAAAAAAGGGTGTTTGGAAAAGATAATGGATCCACTTCTAGTTGGAGCTATAAATCCTGAGTCCATGAAAAAGTTTGCAGAAGCATCAGAGAAATGTCTAGCTGAACATGGTGTAGACAGGCCAAGCATGGGGGATGTATTGTGGAATTTGGAGTATGCATTACAACTACAAGAAGCTTTCTCACAAGGCAAAACTGAAGACGAAAACAAAGCTGCAAGTACGACGGCAACTGTCACCCCGGCCACACCTCCCGCTGTCGAAGCTTCGACAAATGCATCGAACTCCGACAACCGCTCTGTCGTGCAGCCAGAACAGAATAGGCAACCAGCAGAGGTTCAAGCCATTGATGATCATTCAGGAAGTGCAATGTTTGCTCATTTTTCTAATCTCAATGGTAGATGA


Protein sequences

Name Description Sequence
Cucsa.004440.1 Malectin/receptor-like protein kinase family protein (best arabidopsis hit)

MEIKEKKRTSTISSPLMSSSSMAILLVFLCFIFNCPNIAFATGPGASFIPKDNFLIDCGANKEVGALPDGRVFKTDEQSKQYLDAKDDIIATATPEMKAPSPVDLTARVFLQEATYIFQMAEPGWHWLRLHFLPVKSNDFDLLQAKFSVATENYVLLHSFNINNESTFVLKEFLLNITEPKLSIKFLPMRNSAAFINAIEVVSAPVDLIADSNVELSPVGTIEGLSKYAFQTLYRLNMGGPIITPRNDTLGRTWETDEVYRTPKAAGSSVVVQTNSIKYQGGLKETGMLIAPPSVYASAVQMGDAQVSVPNFNITWKFEADPSFGYLVRFHFCDIVSKVLNDIYFNVYVNGKAAITNLDLSHKLGSLATAYYKDVVVNASLIVDGLTVQISPANVDTGDSNAILNGIEVLKISNSVNSLDGEFGVDGKSANGSNRGTVAAVGFAMMFGAFVGLGAMVMKWHKRPQDWQKRNSFSSWLLPVHAGDSSFMTSKTSYGSHKTNIYSSTLGLGRFFTLAELQEATKNFDPNSIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGDVLWNLEYALQLQEAFSQGKTEDENKAASTTATVTPATPPAVEASTNASNSDNRSVVQPEQNRQPAEVQAIDDHSGSAMFAHFSNLNGR*

Domains

Domain Start-End Description Sequence

Seg: seg
9-25 seg

TSTISSPLMSSSSMAIL

HMMPanther: PTHR24420
46-865 FAMILY NOT NAMED,FAMILY NOT NAMED

ASFIPKDNFLIDCGANKEVGALPDGRVFKTDEQSKQYLDAKDDIIATATPEMKAPSPVDLTARVFLQEATYIFQMAEPGWHWLRLHFLPVKSNDFDLLQAKFSVATENYVLLHSFNINNESTFVLKEFLLNITEPKLSIKFLPMRNSAAFINAIEVVSAPVDLIADSNVELSPVGTIEGLSKYAFQTLYRLNMGGPIITPRNDTLGRTWETDEVYRTPKAAGSSVVVQTNSIKYQGGLKETGMLIAPPSVYASAVQMGDAQVSVPNFNITWKFEADPSFGYLVRFHFCDIVSKVLNDIYFNVYVNGKAAITNLDLSHKLGSLATAYYKDVVVNASLIVDGLTVQISPANVDTGDSNAILNGIEVLKISNSVNSLDGEFGVDGKSANGSNRGTVAAVGFAMMFGAFVGLGAMVMKWHKRPQDWQKRNSFSSWLLPVHAGDSSFMTSKTSYGSHKTNIYSSTLGLGRFFTLAELQEATKNFDPNSIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGDVLWNLEYALQLQEAFSQGKTEDENKAASTTATVTPATPPAVEASTNASNSDNRSVVQPEQNRQPAEVQAIDDHSGSA

HMMPanther: PTHR24420:SF550
46-865 SUBFAMILY NOT NAMED

ASFIPKDNFLIDCGANKEVGALPDGRVFKTDEQSKQYLDAKDDIIATATPEMKAPSPVDLTARVFLQEATYIFQMAEPGWHWLRLHFLPVKSNDFDLLQAKFSVATENYVLLHSFNINNESTFVLKEFLLNITEPKLSIKFLPMRNSAAFINAIEVVSAPVDLIADSNVELSPVGTIEGLSKYAFQTLYRLNMGGPIITPRNDTLGRTWETDEVYRTPKAAGSSVVVQTNSIKYQGGLKETGMLIAPPSVYASAVQMGDAQVSVPNFNITWKFEADPSFGYLVRFHFCDIVSKVLNDIYFNVYVNGKAAITNLDLSHKLGSLATAYYKDVVVNASLIVDGLTVQISPANVDTGDSNAILNGIEVLKISNSVNSLDGEFGVDGKSANGSNRGTVAAVGFAMMFGAFVGLGAMVMKWHKRPQDWQKRNSFSSWLLPVHAGDSSFMTSKTSYGSHKTNIYSSTLGLGRFFTLAELQEATKNFDPNSIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGDVLWNLEYALQLQEAFSQGKTEDENKAASTTATVTPATPPAVEASTNASNSDNRSVVQPEQNRQPAEVQAIDDHSGSA

HMMPfam: PF12819
IPR024788
56-412 Malectin_like,Carbohydrate-binding protein of the ER
Malectin-like carbohydrate-binding domain

IDCGANKEVGALPDGRVFKTDEQSKQYLDAKDDIIATATPEMKAPSPVDLTARVFLQEATYIFQMAEPGWHWLRLHFLPVKSNDFDLLQAKFSVATENYVLLHSFNINNESTFVLKEFLLNITEPKLSIKFLPMRNSAAFINAIEVVSAPVDLIADSNVELSPVGTIEGLSKYAFQTLYRLNMGGPIITPRNDTLGRTWETDEVYRTPKAAGSSVVVQTNSIKYQGGLKETGMLIAPPSVYASAVQMGDAQVSVPNFNITWKFEADPSFGYLVRFHFCDIVSKVLNDIYFNVYVNGKAAITNLDLSHKLGSLATAYYKDVVVNASLIVDGLTVQISPANVDTGDSNAILNGIEVLKI

Seg: seg
438-456 seg

VAAVGFAMMFGAFVGLGAM

superfamily: SSF56112
IPR011009
494-801 Protein kinase-like (PK-like)
Protein kinase-like domain

YGSHKTNIYSSTLGLGRFFTLAELQEATKNFDPNSIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGDVLWNLEYALQLQE

Gene3D: G3DSA:3.30.200.20
511-585 no description

FFTLAELQEATKNFDPNSIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIG

HMMSmart: SM00220
IPR002290
524-796 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDPNSIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGDVLWNLEYA

HMMSmart: SM00219
IPR020635
524-793 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDPNSIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGDVLWNL

ProfileScan: PS50011
IPR000719
524-796 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDPNSIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGDVLWNLEYA

HMMPfam: PF07714
IPR001245
528-788 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SIIGVGGFGNVYLGVIDEGTKVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGD

PatternScan: PS00107
IPR017441
530-552 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGVGGFGNVYLGVIDEGTKVAVK

Gene3D: G3DSA:1.10.510.10
586-792 no description

YCDENAEMILVYEFMSNGPFRDHLYGKDISPLSWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKTTNILLDENFTAKVADFGLSKDAPMGQGHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEALCARPAINPSLTREQVNLADWAMQCKKKGCLEKIMDPLLVGAINPESMKKFAEASEKCLAEHGVDRPSMGDVLWN

PatternScan: PS00108
IPR008271
644-656 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKTTNILL

Seg: seg
814-833 seg

AASTTATVTPATPPAVEAST






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox