PRGDB00150853 (Cucsa.004600.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.004600.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class N
Domain Type NBS
Gene Species Pennisetum glaucum

Comment?

pleiotropic drug resistance 12 (best arabidopsis hit)

DNA Sequence

ATGGAGGTATTCTCAAGATCAATGCATAGGGAAGATGATGAAACAGCTCTTAAATGGGCAGCATTGGAGAGACTTCCTACTTATAGACGCTTAAGAACAAGTTTATTGACATCGTCTTGTGGTGAGGCCAATGAAGTTGAAGTTGACAAAATTGGGGTTCAAGAAAGGAAGAGTTTGATGGAGAAGTTGGTTAGTGATACAGAAGTTGACAATGAAAAATTCCTGTTGAAGCTGAAGAAACGCATTGATAGAGTTGGAATTGATATTCCCACCATTGAAGTAAGATTTGAGCATCTTAGAGTTGAAGCTGAAGCATATATTGGACAGAGAGCTTTGCCTACTATCTTCAACTTCTTTGCCAACTTAATGGAAGGGTTTTTGGCCAATCTCCGCATACTATCAAGTAAAAAGAAACAGCTGACTATCCTTCATGATGTTAGTGGAGTCATTAAGCCAAGCAGGATGACACTGCTTTTAGGCCCTCCAGATTCCGGAAAAACGACGCTTTTGTTGGCTTTGGCAGGGAGGCTTGCTTCTGATCTGAAGGTCTCTGGGAAGGTGTCTTATAATGGCTATAGTTTGAATGAGTTTGTTCCACAAAGAACTGCTGCCTATGTGAGCCAAAATGATGTCCATCTTCCAGAAATGACAGTAAGAGAAATCTTGGCCTTTTCTGCAAGATATCAAGGAGTCGGATCTCGTCATGAGTTGCTGGAAGAGCTGATAAGAAGAGAGAAGGAAGCAAACATTCTCCCTGACCCGGATATTGACGTGTTCATGAAGGCAGCATCACTAGAAGGCCAAAAGAGAAGCCTGATCACAGATTATGTTCTGAAGTTACTGGGACTGGAAACTTGTGCAGACACCAGGGTTGGAGATGAAATGCTCAAAGGCATTTCTGGAGGACAGAGGAAGCGTCTCACCACCGGTGAGATAATTTGTGGGTCTGCAAATGTACTGTTCATGGATGACATATCTACAGGCCTAGATAGTTCTACAACCTTTCAAGTTGTGAACTCAATCAAGGAATACATTCACATTTTCAATGGAACTGCTGTTCTTTCCCTTCTTCAACCTGCACCAGAAACTTTTAAACTTTTTGATGACATTATTCTCCTGTCTGAAGGTCAAACTGTGTACCAAGGTCCTTGCCAGCAAGTCCTTGAATTTTTTGAGTTCATGGGCTTCAAATGTCCTGAAAGGAAAGGAGTGGCAGACTATTTGCAAGAAGTGACTTCAAGGAAAGATCAGCAGCAATATTGGGCAGAGAAGAATAAGCCTTACACATATATCTCTGTTAAACAGTTTGCTGAAGCATTCAAATCCTTTCATGTGGGAAGGAAACTAGAAGAGGAATTAGCAGTTCCCTTTGACAAAAGCAAGTGCCACCCTGCTGTTTTGGCAACAAAAAAGTATGGCATGGGATATAAGCAACTTTGGAAGGCCTGTTTTGATAGAGAAGTCTTGTTGATGAAGCGTAACTCATTTGTTCACATCTTCAAGCTTGCCCAAATTTCCCTGATATGTCCCCGAGACTCAATAAATGATGGACAAATTTATATGGGTGCTTTGTTTAATGCACTGGTTATTTGTATGTTCAATGGGATGTCTGAGCTTCCATTAACAATTGGTAAGCTTCCTGTTTTCTACAAGCAAAGGGACCTCCTTTTCTTCCCAGCTTGGGCATATGCTCTTCCAGCTAGCATTCTAAAAATCCCTGTCTCCTTTGTGGAAGTCGCACTTTGGGTTTTTATCTCGTATTATGTTACTGGGTTCGATCCAAGTGTGGAAAGGTTTTTTAAACAGTACCTTGTATTAGTTTTTGCCAACCAATTGGCTTCTGCACTGTTCCGATTAATTGCAGCTGTTTCTAGAAGCTTAGTAGTTTCAAGCACATTCGGTTCATTTGTTCTGTTGATACTCTATGGAAATGATGGTTATATTCTCTCACGACATAATATGAAAAAGTGGTGGAAATGGGCTTACTGGGTATCACCTATGATGTATGGTCAGAATTCATTGGCAGTGAACGAATTCCGAGGAAAAAGTTGGGATCAAGTTGTCCCTACTGGGGAAACTCTAGGAGTTCTGATCTTGAAGGTTCATGGCTTCTTCCAATCAGATTATTGGTATTGGATTGGAGTGGGTGCAATGGTTGGATTCATTCTTCTATTTAACTTTGGCTATGTCTTAGCCCTCACTTATCTCAACCCACTGAAAAAGCATCAGACCGCGAAACCACAAGTCTCAGAGAGCAATGAGAAAGAGTTTGAGATCAGAAACACCCCATCTAGGAAAAATATTGCAGCTAATGAAAGTGAAAGTATGCGAGTTTCCACCCAAAGATGGAATGAAGCAACTAGCAAGGCCACTTGTAATAAGAGAAAAGAAGTTGTTCTTCCATTTAAACAGTATGTGCTCACTTTTGATGAGATAGTATACTCGGTTGATATGCCGCAGGAAATGAAGAAGCAAGGTATCATAGAAGATAAACTAGTGCTTTTGAAGGGTGTGAGTGGTGCTTTTAAGCCTGGTGTTCTCACAGCTTTGATGGGCGTGAGCGGAGCGGGGAAAACGACTTTGATGGATGTACTAGCCGGGAGAAAAACGGGTGGATATATAGAGGGAATCATCAAAGTTTCTGGCTATACAAAAAAGCAAGAAACTTTTACTCGAATTTCTGGTTATTGTGAACAAAATGACATCCATTCTCCTCATGTTACTGTTTATGAGTCCCTGCTCTACTCGGCATGGCTACGTCTTGGCTCTGATGTGAGCAAAGAAACAAGAAAGATGTTTGTAGAAGAAATCATGGAGCTGGTTGAACTCGACACATTGAGGCAAGCAATAGTCGGATTGCCTGGTGTAAATGGTCTCTCAACCGAGCAGCGCAAAAGGTTGACAATAGCTGTAGAGTTGGTGGCAAACCCTTCCATAATATTTCTTGATGAGCCAACTTCAGGACTAGATGCAAGAGCTGCTGCAATAGTTATGCGGACAGTTCGGAACACTGTCGATACAGGACGAACAGTTGTGTGCACAATCCATCAACCAAGCATCGACATATTTGAATCCTTTGATGAGCTTTTGCTATTGAAGCAAGGAGGAGAGTCTATATATGTTGGACCACTTGGTCATCACTCTTGCCATTTGATCAAATATTTTGAGGGAATCGAGGGTACGAGGAGGATAAAAGAGGGTCAAAATCCAGCGACTTGGATGTTAGAAGTAACCTCCTCAACTCATGAAATGGCATTGAGGGTTGATTTTGCTGATCTATTCAAAAAATCTGAACTCTATAGAAGAAATAAGGAACAAATCAAAGAACTGAGTCAACCTCCCCCTGCTTCTAATGATATCCATTTTCAAACCAAATATTCCCAGCCTTCTTGGAACCAATTCTTGGCTTGCTTATGGAAGCAGCATTTGTCGTATTGGCGTAATCCATCATACATTGCATCCAGATTTCTGTTCACTCTTGGGTCATCGTTGATACTCGGGACAATGTTTTGGAACCTAGGCTCCAAGAGAACAACATACATAAATATGTTTAATTCGGTTGGTGCGATGTATACGGCTTCGCTTTTCCTTGGTATACAAAATGCTGGAGCCATACAACCAGTCGTATCCATCGAGCGAACTGTCTACTATAGAGAAAGAGCTGCAGGATTGTATTCAGCCTTTCCATATGCCTTTGCTCAGGTTATAATTGAGCTTCCATATACTTTTTTACAATCTTTGATGTATTGCAACATAGTATATGCAATGATGGCATTCGAATGGTCTTTTGCTAAGGTTCTTTGGTTTTTCTTCTTCATGTACTTCACTTTCCTCTACTTTACCTACTATGGCATGATGGGGATCGCTGCCACGCCGAGTTACCATTTCAGTTTGATTATTTCGACTGCATTTTACGGGATGTGGAACCTCTTTTGTGGCTTTCTCATCCCCAGAACAAGGATTCCTGTGTGGTGGAGATGGTTCTATTGGACTTGTCCATTGTCATGGACATTGTATGGATTAATAGCTTCACAATTTGGAGATATAGAGGAGAAATTGGATACAGGGGAGACTGTTAAGGAGTTTATAAGAGAATTCTTTGGTTTTAGACATGATTTTCTTGGAGTTGTTGCTGCTGTTATTGTTGGCCTTGCTGTTTTCTTTGCACTCACATTTGCCATTTCTATCAAAATCTTTAATTTCCAAAGGAGATAG


Protein sequences

Name Description Sequence
Cucsa.004600.1 pleiotropic drug resistance 12 (best arabidopsis hit)

MEVFSRSMHREDDETALKWAALERLPTYRRLRTSLLTSSCGEANEVEVDKIGVQERKSLMEKLVSDTEVDNEKFLLKLKKRIDRVGIDIPTIEVRFEHLRVEAEAYIGQRALPTIFNFFANLMEGFLANLRILSSKKKQLTILHDVSGVIKPSRMTLLLGPPDSGKTTLLLALAGRLASDLKVSGKVSYNGYSLNEFVPQRTAAYVSQNDVHLPEMTVREILAFSARYQGVGSRHELLEELIRREKEANILPDPDIDVFMKAASLEGQKRSLITDYVLKLLGLETCADTRVGDEMLKGISGGQRKRLTTGEIICGSANVLFMDDISTGLDSSTTFQVVNSIKEYIHIFNGTAVLSLLQPAPETFKLFDDIILLSEGQTVYQGPCQQVLEFFEFMGFKCPERKGVADYLQEVTSRKDQQQYWAEKNKPYTYISVKQFAEAFKSFHVGRKLEEELAVPFDKSKCHPAVLATKKYGMGYKQLWKACFDREVLLMKRNSFVHIFKLAQISLICPRDSINDGQIYMGALFNALVICMFNGMSELPLTIGKLPVFYKQRDLLFFPAWAYALPASILKIPVSFVEVALWVFISYYVTGFDPSVERFFKQYLVLVFANQLASALFRLIAAVSRSLVVSSTFGSFVLLILYGNDGYILSRHNMKKWWKWAYWVSPMMYGQNSLAVNEFRGKSWDQVVPTGETLGVLILKVHGFFQSDYWYWIGVGAMVGFILLFNFGYVLALTYLNPLKKHQTAKPQVSESNEKEFEIRNTPSRKNIAANESESMRVSTQRWNEATSKATCNKRKEVVLPFKQYVLTFDEIVYSVDMPQEMKKQGIIEDKLVLLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGIIKVSGYTKKQETFTRISGYCEQNDIHSPHVTVYESLLYSAWLRLGSDVSKETRKMFVEEIMELVELDTLRQAIVGLPGVNGLSTEQRKRLTIAVELVANPSIIFLDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLLKQGGESIYVGPLGHHSCHLIKYFEGIEGTRRIKEGQNPATWMLEVTSSTHEMALRVDFADLFKKSELYRRNKEQIKELSQPPPASNDIHFQTKYSQPSWNQFLACLWKQHLSYWRNPSYIASRFLFTLGSSLILGTMFWNLGSKRTTYINMFNSVGAMYTASLFLGIQNAGAIQPVVSIERTVYYRERAAGLYSAFPYAFAQVIIELPYTFLQSLMYCNIVYAMMAFEWSFAKVLWFFFFMYFTFLYFTYYGMMGIAATPSYHFSLIISTAFYGMWNLFCGFLIPRTRIPVWWRWFYWTCPLSWTLYGLIASQFGDIEEKLDTGETVKEFIREFFGFRHDFLGVVAAVIVGLAVFFALTFAISIKIFNFQRR*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50893
IPR003439
127-400 ABC_TRANSPORTER_2
ABC transporter-like

LANLRILSSKKKQLTILHDVSGVIKPSRMTLLLGPPDSGKTTLLLALAGRLASDLKVSGKVSYNGYSLNEFVPQRTAAYVSQNDVHLPEMTVREILAFSARYQGVGSRHELLEELIRREKEANILPDPDIDVFMKAASLEGQKRSLITDYVLKLLGLETCADTRVGDEMLKGISGGQRKRLTTGEIICGSANVLFMDDISTGLDSSTTFQVVNSIKEYIHIFNGTAVLSLLQPAPETFKLFDDIILLSEGQTVYQGPCQQVLEFFEFMGFKCPE

Gene3D: G3DSA:3.40.50.300
138-389 no description

KQLTILHDVSGVIKPSRMTLLLGPPDSGKTTLLLALAGRLASDLKVSGKVSYNGYSLNEFVPQRTAAYVSQNDVHLPEMTVREILAFSARYQGVGSRHELLEELIRREKEANILPDPDIDVFMKAASLEGQKRSLITDYVLKLLGLETCADTRVGDEMLKGISGGQRKRLTTGEIICGSANVLFMDDISTGLDSSTTFQVVNSIKEYIHIFNGTAVLSLLQPAPETFKLFDDIILLSEGQTVYQGPCQQVLE

superfamily: SSF52540
140-404 P-loop containing nucleoside triphosphate hydrolases

LTILHDVSGVIKPSRMTLLLGPPDSGKTTLLLALAGRLASDLKVSGKVSYNGYSLNEFVPQRTAAYVSQNDVHLPEMTVREILAFSARYQGVGSRHELLEELIRREKEANILPDPDIDVFMKAASLEGQKRSLITDYVLKLLGLETCADTRVGDEMLKGISGGQRKRLTTGEIICGSANVLFMDDISTGLDSSTTFQVVNSIKEYIHIFNGTAVLSLLQPAPETFKLFDDIILLSEGQTVYQGPCQQVLEFFEFMGFKCPERKGV

HMMSmart: SM00382
IPR003593
152-376 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PSRMTLLLGPPDSGKTTLLLALAGRLASDLKVSGKVSYNGYSLNEFVPQRTAAYVSQNDVHLPEMTVREILAFSARYQGVGSRHELLEELIRREKEANILPDPDIDVFMKAASLEGQKRSLITDYVLKLLGLETCADTRVGDEMLKGISGGQRKRLTTGEIICGSANVLFMDDISTGLDSSTTFQVVNSIKEYIHIFNGTAVLSLLQPAPETFKLFDDIILLSEG

HMMPfam: PF00005
IPR003439
167-324 ABC_tran
ABC transporter-like

TTLLLALAGRLASDLKVSGKVSYNGYSLNEFVPQRTAAYVSQNDVHLPEMTVREILAFSARYQGVGSRHELLEELIRREKEANILPDPDIDVFMKAASLEGQKRSLITDYVLKLLGLETCADTRVGDEMLKGISGGQRKRLTTGEIICGSANVLFMDD

Seg: seg
169-181 seg

LLLALAGRLASDL

Seg: seg
234-247 seg

RHELLEELIRREKE

HMMPanther: PTHR19241:SF10
328-1404 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSSTTFQVVNSIKEYIHIFNGTAVLSLLQPAPETFKLFDDIILLSEGQTVYQGPCQQVLEFFEFMGFKCPERKGVADYLQEVTSRKDQQQYWAEKNKPYTYISVKQFAEAFKSFHVGRKLEEELAVPFDKSKCHPAVLATKKYGMGYKQLWKACFDREVLLMKRNSFVHIFKLAQISLICPRDSINDGQIYMGALFNALVICMFNGMSELPLTIGKLPVFYKQRDLLFFPAWAYALPASILKIPVSFVEVALWVFISYYVTGFDPSVERFFKQYLVLVFANQLASALFRLIAAVSRSLVVSSTFGSFVLLILYGNDGYILSRHNMKKWWKWAYWVSPMMYGQNSLAVNEFRGKSWDQVVPTGETLGVLILKVHGFFQSDYWYWIGVGAMVGFILLFNFGYVLALTYLNPLKKHQTAKPQVSESNEKEFEIRNTPSRKNIAANESESMRVSTQRWNEATSKATCNKRKEVVLPFKQYVLTFDEIVYSVDMPQEMKKQGIIEDKLVLLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGIIKVSGYTKKQETFTRISGYCEQNDIHSPHVTVYESLLYSAWLRLGSDVSKETRKMFVEEIMELVELDTLRQAIVGLPGVNGLSTEQRKRLTIAVELVANPSIIFLDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLLKQGGESIYVGPLGHHSCHLIKYFEGIEGTRRIKEGQNPATWMLEVTSSTHEMALRVDFADLFKKSELYRRNKEQIKELSQPPPASNDIHFQTKYSQPSWNQFLACLWKQHLSYWRNPSYIASRFLFTLGSSLILGTMFWNLGSKRTTYINMFNSVGAMYTASLFLGIQNAGAIQPVVSIERTVYYRERAAGLYSAFPYAFAQVIIELPYTFLQSLMYCNIVYAMMAFEWSFAKVLWFFFFMYFTFLYFTYYGMMGIAATPSYHFSLIISTAFYGMWNLFCGFLIPRTRIPVWWRWFYWTCPLSWTLYGLIASQFGDIEEKLDTGETVKEFIREFFGFRHDFLGVVAAVIVGLAVFFALTFAISIKIFNFQRR

HMMPanther: PTHR19241
328-1404 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDSSTTFQVVNSIKEYIHIFNGTAVLSLLQPAPETFKLFDDIILLSEGQTVYQGPCQQVLEFFEFMGFKCPERKGVADYLQEVTSRKDQQQYWAEKNKPYTYISVKQFAEAFKSFHVGRKLEEELAVPFDKSKCHPAVLATKKYGMGYKQLWKACFDREVLLMKRNSFVHIFKLAQISLICPRDSINDGQIYMGALFNALVICMFNGMSELPLTIGKLPVFYKQRDLLFFPAWAYALPASILKIPVSFVEVALWVFISYYVTGFDPSVERFFKQYLVLVFANQLASALFRLIAAVSRSLVVSSTFGSFVLLILYGNDGYILSRHNMKKWWKWAYWVSPMMYGQNSLAVNEFRGKSWDQVVPTGETLGVLILKVHGFFQSDYWYWIGVGAMVGFILLFNFGYVLALTYLNPLKKHQTAKPQVSESNEKEFEIRNTPSRKNIAANESESMRVSTQRWNEATSKATCNKRKEVVLPFKQYVLTFDEIVYSVDMPQEMKKQGIIEDKLVLLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGIIKVSGYTKKQETFTRISGYCEQNDIHSPHVTVYESLLYSAWLRLGSDVSKETRKMFVEEIMELVELDTLRQAIVGLPGVNGLSTEQRKRLTIAVELVANPSIIFLDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLLKQGGESIYVGPLGHHSCHLIKYFEGIEGTRRIKEGQNPATWMLEVTSSTHEMALRVDFADLFKKSELYRRNKEQIKELSQPPPASNDIHFQTKYSQPSWNQFLACLWKQHLSYWRNPSYIASRFLFTLGSSLILGTMFWNLGSKRTTYINMFNSVGAMYTASLFLGIQNAGAIQPVVSIERTVYYRERAAGLYSAFPYAFAQVIIELPYTFLQSLMYCNIVYAMMAFEWSFAKVLWFFFFMYFTFLYFTYYGMMGIAATPSYHFSLIISTAFYGMWNLFCGFLIPRTRIPVWWRWFYWTCPLSWTLYGLIASQFGDIEEKLDTGETVKEFIREFFGFRHDFLGVVAAVIVGLAVFFALTFAISIKIFNFQRR

HMMPfam: PF01061
IPR013525
479-679 ABC2_membrane
ABC-2 type transporter

LWKACFDREVLLMKRNSFVHIFKLAQISLICPRDSINDGQIYMGALFNALVICMFNGMSELPLTIGKLPVFYKQRDLLFFPAWAYALPASILKIPVSFVEVALWVFISYYVTGFDPSVERFFKQYLVLVFANQLASALFRLIAAVSRSLVVSSTFGSFVLLILYGNDGYILSRHNMKKWWKWAYWVSPMMYGQNSLAVNEF

HMMPfam: PF08370
IPR013581
684-744 PDR_assoc
Plant PDR ABC transporter associated

WDQVVPTGETLGVLILKVHGFFQSDYWYWIGVGAMVGFILLFNFGYVLALTYLNPLKKHQT

superfamily: SSF52540
799-1046 P-loop containing nucleoside triphosphate hydrolases

VLPFKQYVLTFDEIVYSVDMPQEMKKQGIIEDKLVLLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGIIKVSGYTKKQETFTRISGYCEQNDIHSPHVTVYESLLYSAWLRLGSDVSKETRKMFVEEIMELVELDTLRQAIVGLPGVNGLSTEQRKRLTIAVELVANPSIIFLDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLLKQGGESIYVGPLGH

ProfileScan: PS50893
IPR003439
807-1059 ABC_TRANSPORTER_2
ABC transporter-like

LTFDEIVYSVDMPQEMKKQGIIEDKLVLLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGIIKVSGYTKKQETFTRISGYCEQNDIHSPHVTVYESLLYSAWLRLGSDVSKETRKMFVEEIMELVELDTLRQAIVGLPGVNGLSTEQRKRLTIAVELVANPSIIFLDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLLKQGGESIYVGPLGHHSCHLIKYFEGIE

Gene3D: G3DSA:3.40.50.300
830-1043 no description

DKLVLLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGIIKVSGYTKKQETFTRISGYCEQNDIHSPHVTVYESLLYSAWLRLGSDVSKETRKMFVEEIMELVELDTLRQAIVGLPGVNGLSTEQRKRLTIAVELVANPSIIFLDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLLKQGGESIYVGP

HMMSmart: SM00382
IPR003593
844-1036 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGIIKVSGYTKKQETFTRISGYCEQNDIHSPHVTVYESLLYSAWLRLGSDVSKETRKMFVEEIMELVELDTLRQAIVGLPGVNGLSTEQRKRLTIAVELVANPSIIFLDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELLLLKQGG

HMMPfam: PF00005
IPR003439
859-987 ABC_tran
ABC transporter-like

TTLMDVLAGRKTGGYIEGIIKVSGYTKKQETFTRISGYCEQNDIHSPHVTVYESLLYSAWLRLGSDVSKETRKMFVEEIMELVELDTLRQAIVGLPGVNGLSTEQRKRLTIAVELVANPSIIFLDEPTS

HMMPfam: PF01061
IPR013525
1133-1346 ABC2_membrane
ABC-2 type transporter

QFLACLWKQHLSYWRNPSYIASRFLFTLGSSLILGTMFWNLGSKRTTYINMFNSVGAMYTASLFLGIQNAGAIQPVVSIERTVYYRERAAGLYSAFPYAFAQVIIELPYTFLQSLMYCNIVYAMMAFEWSFAKVLWFFFFMYFTFLYFTYYGMMGIAATPSYHFSLIISTAFYGMWNLFCGFLIPRTRIPVWWRWFYWTCPLSWTLYGLIASQF

Seg: seg
1269-1283 seg

FFFFMYFTFLYFTYY

Seg: seg
1373-1390 seg

FLGVVAAVIVGLAVFFAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox