PRGDB00150854 (Cucsa.004690.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.004690.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGCACAAGGCCAAGAAATAACACCTGGGTCTACGCTAATTTCAACCATGGCCAATTTTTCGCTCGGCTTTTACAGTCCTAGCTTATTGAACAACAGTTATATAGCGATTTGGTACCACAGTGATTCACAGAACCCAGTGTGGATTGCCAATCGTAATTTTGCATTTCCAAGAGACTTTGGGACACCTTGTCTCACAATTGACAGCAATGGGAGCTTGAAGATTGTCCCTAAAGAAGGAAAAGGAAGAAATGGATATAATTTCTATCTCTTTGAAGTTGAAGAACCCACCAACAGCAGTGCTATTCTTCTAGACAATGGCAACTTTGTATTGTGTGTGTTGAATCTAGATGGATCGATTAAGCGACAACTATGGCAGAGTTTTGATCATCCAACAGACACTCTCCTTCCTGGGATGAAACTTGGGATCAACCACAAAACTGGATCCATTTGGTCTATAACATCCCGAAGAGTGAATCCCAACAATACAAACCAGTTGCTGATATTACATAGAGGAAGCGTTTTCTGGACCAGTGGAAACTGGAAGGACGGGCGATTCGAGTTCTCTGAAGAACTTTCCAACATCAACAATCAAGAATTCGTGTTCAGTCGATTTTCAAATGAGAACGAGACTTTTTTCAATTACTCCATCTCCAATCTCTTTCAATTGCCTAACCATAACAAGGGATTGATAGAAGTTCAAACCTTCTTGAGATTGGGCAACGACGGGAAATTGGTGGGGCGTAATTGGGACTCAAAAGTTGAATGTCCCTATTTTGAAAACGAGTTGTTTGAGCCTAAGCATGTTTCTGAAGTTGGGTGTGTGGGGAAAATGCAGCACAAAGTACCCGAGTGCCGAAATCCACCAAAACAGTATTCCACTTCACAGAGATTTGGAAACATGGAGAGAAATGGTTTGAGGTTCAGAGAAAGTGAGAACCTGACCATTTACGATTGTGAAAAGAATTGCATTTCAAGCTGTGATTGCATTGCCTTTAGTTCTACAAACGAAGAAGGCACTGGCTGTGAGATGTGGAATGTGGGAGCAACGTTTATTCCAGTGGAGGGAGGCAAACGGATAATTTGGTCTCTTGAGATAGTCGAAGGAAAAGGAGAAAAAAGGGTGTGGTTGCAAGTTACTATAGGTCTAATAGTACCTGTAACTTCTCTCCTATTGTGTTTTCTTGTCTATCTCAAATGGAAAACACAAATACTCAAAGCTATTAGAAAAATAAGGAGGGATTCTGAACATCAAAACTTTCTGCAAGAATTGGGAGCCAAAACTAAGAGTTTTGACATTCCAACTATTATGAACAAGCAAAGAAGAGACGTAAGGAACTCTGAATTGCAGTTTTTCAGTTTTAGAAGTGTAGTTTCTACAACAAACAATTTTGCTGACAATTGTAAGCTTGGAGAGGGTGGGTTTGGACCAGTTTATAAGGGAACTTTGGCCGATGGCCAAGAAGTTGCCATTAAAAGGCTGTCAAATAAATCTGGACAAGGGATTGAAGAGTTCAAGAATGAAGTCATCCTGATTGCCAAACTGCAACACACTAATCTGGTTAGGCTTATCGGTTGTTGCATTCATAAAGAAGAGAGGTTATTGGTGTATGAGTGCATGCCCAACAAAAGCCTTGACTCCTTCCTCTTTGATCCAGTTAGAAAGCTAACTCTCACTTGGGACAAACGGCAACACATAATCCAAGGGATAATTCAAGGACTACTTTACCTTCACAACTACTCAAGACTAAGAATAGTTCATCGAGATCTAAAAATTAGCAACATCTTGCTCGATGCTCAGATGAATGCAAAAATATCAGATTTTGGATGTCAAGTAAATTATTTTCAGGCATGGGAATTGTGGGTGAACGGCAGAGGAGAAGAATTGATTGATTCAACTTTGTGTAACTCTGATCAGAAACCAAAGGCTCTAAGATGCATCCATGTTAGCCTTCTATGCGTACAACAAATGGCAGAATATAGACCTACCATGCTTGATGTTTATTCCATGATTCAGAATGATTCTACTCAACTTCCATTGCCAAAACAACCTCCGTTTTTCATCACCCATAACTCCAAACTGGAAGTGGTGACAGATAAATCGGAATCAGCAACACAAATATATTCTTCCAATGATATGTCAGTCTCTATGATGGTTACGAGATGA


Protein sequences

Name Description Sequence
Cucsa.004690.1 lectin protein kinase family protein (best arabidopsis hit)

MAQGQEITPGSTLISTMANFSLGFYSPSLLNNSYIAIWYHSDSQNPVWIANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCVLNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRVNPNNTNQLLILHRGSVFWTSGNWKDGRFEFSEELSNINNQEFVFSRFSNENETFFNYSISNLFQLPNHNKGLIEVQTFLRLGNDGKLVGRNWDSKVECPYFENELFEPKHVSEVGCVGKMQHKVPECRNPPKQYSTSQRFGNMERNGLRFRESENLTIYDCEKNCISSCDCIAFSSTNEEGTGCEMWNVGATFIPVEGGKRIIWSLEIVEGKGEKRVWLQVTIGLIVPVTSLLLCFLVYLKWKTQILKAIRKIRRDSEHQNFLQELGAKTKSFDIPTIMNKQRRDVRNSELQFFSFRSVVSTTNNFADNCKLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGCCIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGCQVNYFQAWELWVNGRGEELIDSTLCNSDQKPKALRCIHVSLLCVQQMAEYRPTMLDVYSMIQNDSTQLPLPKQPPFFITHNSKLEVVTDKSESATQIYSSNDMSVSMMVTR*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50927
IPR001480
1-124 BULB_LECTIN
Bulb-type lectin domain

MAQGQEITPGSTLISTMANFSLGFYSPSLLNNSYIAIWYHSDSQNPVWIANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCVLNLDGSIKRQL

HMMPanther: PTHR24420
3-720 FAMILY NOT NAMED,FAMILY NOT NAMED

QGQEITPGSTLISTMANFSLGFYSPSLLNNSYIAIWYHSDSQNPVWIANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCVLNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRVNPNNTNQLLILHRGSVFWTSGNWKDGRFEFSEELSNINNQEFVFSRFSNENETFFNYSISNLFQLPNHNKGLIEVQTFLRLGNDGKLVGRNWDSKVECPYFENELFEPKHVSEVGCVGKMQHKVPECRNPPKQYSTSQRFGNMERNGLRFRESENLTIYDCEKNCISSCDCIAFSSTNEEGTGCEMWNVGATFIPVEGGKRIIWSLEIVEGKGEKRVWLQVTIGLIVPVTSLLLCFLVYLKWKTQILKAIRKIRRDSEHQNFLQELGAKTKSFDIPTIMNKQRRDVRNSELQFFSFRSVVSTTNNFADNCKLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGCCIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGCQVNYFQAWELWVNGRGEELIDSTLCNSDQKPKALRCIHVSLLCVQQMAEYRPTMLDVYSMIQNDSTQLPLPKQPPFFITHNSKLEVVTDKSESATQIYSSNDMSVSMMVT

HMMPanther: PTHR24420:SF430
3-720 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QGQEITPGSTLISTMANFSLGFYSPSLLNNSYIAIWYHSDSQNPVWIANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCVLNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRVNPNNTNQLLILHRGSVFWTSGNWKDGRFEFSEELSNINNQEFVFSRFSNENETFFNYSISNLFQLPNHNKGLIEVQTFLRLGNDGKLVGRNWDSKVECPYFENELFEPKHVSEVGCVGKMQHKVPECRNPPKQYSTSQRFGNMERNGLRFRESENLTIYDCEKNCISSCDCIAFSSTNEEGTGCEMWNVGATFIPVEGGKRIIWSLEIVEGKGEKRVWLQVTIGLIVPVTSLLLCFLVYLKWKTQILKAIRKIRRDSEHQNFLQELGAKTKSFDIPTIMNKQRRDVRNSELQFFSFRSVVSTTNNFADNCKLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGCCIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGCQVNYFQAWELWVNGRGEELIDSTLCNSDQKPKALRCIHVSLLCVQQMAEYRPTMLDVYSMIQNDSTQLPLPKQPPFFITHNSKLEVVTDKSESATQIYSSNDMSVSMMVT

HMMSmart: SM00108
IPR001480
4-131 Bulb-type mannose-specific lectin
Bulb-type lectin domain

GQEITPGSTLISTMANFSLGFYSPSLLNNSYIAIWYHSDSQNPVWIANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCVLNLDGSIKRQLWQSFDHP

superfamily: SSF51110
IPR001480
35-160 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

IAIWYHSDSQNPVWIANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCVLNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRVNP

HMMPfam: PF01453
IPR001480
44-158 B_lectin
Bulb-type lectin domain

QNPVWIANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCVLNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRV

Gene3D: G3DSA:2.90.10.10
IPR001480
44-186 no description
Bulb-type lectin domain

QNPVWIANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCVLNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRVNPNNTNQLLILHRGSVFWTSGNWKDGRF

HMMPfam: PF08276
IPR013227
312-346 PAN_2
PAN-2 domain

ENLTIYDCEKNCISSCDCIAFSSTNEEGTGCEMWN

Gene3D: G3DSA:3.30.200.20
445-526 no description

RNSELQFFSFRSVVSTTNNFADNCKLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGC

superfamily: SSF56112
IPR011009
450-702 Protein kinase-like (PK-like)
Protein kinase-like domain

QFFSFRSVVSTTNNFADNCKLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGCCIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGCQVNYFQAWELWVNGRGEELIDSTLCNSDQKPKALRCIHVSLLCVQQMAEYRPTMLDVYSMIQNDSTQLPLPKQPPFFITHNSKLEVVTDKSE

ProfileScan: PS50011
IPR000719
464-721 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FADNCKLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGCCIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGCQVNYFQAWELWVNGRGEELIDSTLCNSDQKPKALRCIHVSLLCVQQMAEYRPTMLDVYSMIQNDSTQLPLPKQPPFFITHNSKLEVVTDKSESATQIYSSNDMSVSMMVTR

HMMSmart: SM00220
IPR002290
464-687 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FADNCKLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGCCIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGCQVNYFQAWELWVNGRGEELIDSTLCNSDQKPKALRCIHVSLLCVQQMAEYRPTMLDVYSMIQNDSTQLPLPKQPPFF

HMMSmart: SM00219
IPR020635
464-671 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FADNCKLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGCCIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGCQVNYFQAWELWVNGRGEELIDSTLCNSDQKPKALRCIHVSLLCVQQMAEYRPTMLDVYSMI

HMMPfam: PF00069
IPR000719
469-611 Pkinase,Ser-thr
Protein kinase, catalytic domain

KLGEGGFGPVYKGTLADGQEVAIKRLSNKSGQGIEEFKNEVILIAKLQHTNLVRLIGCCIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGCQ

Gene3D: G3DSA:1.10.510.10
527-610 no description

CIHKEERLLVYECMPNKSLDSFLFDPVRKLTLTWDKRQHIIQGIIQGLLYLHNYSRLRIVHRDLKISNILLDAQMNAKISDFGC

Seg: seg
566-575 seg

IIQGIIQGLL

PatternScan: PS00108
IPR008271
585-597 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKISNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox