PRGDB00150855 (Cre03.g194100.t1.1)

From PRG Wiki
Jump to: navigation, search
Cre03.g194100.t1.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Chlamydomonas reinhardtii

Comment?

protein tyrosine kinase family protein (best arabidopsis hit)

DNA Sequence

ATGAACTATCAGCAGGGTCCCCAAAGTTACCCGCAGCAGTATGCTCCACCGCAGCCTACATCGGAGGAGCAGGCCATCAGCATTGCCTTGGCTCAAAGCGTTGTAGACCACGAGGCCTGGCGACACCGGGAGCGCGAGCTGCAGGCTGCACAGGCGCACCGAGTTGTCAAGTCAAGCGCCGCAGAGGCGGCCTCGCAAAAGTTCTGGCGAGAAGGAAGCCTTGGCTACGGTGAGGTCGTTGCGGATGGCTTCTACGACATATATGGGGATTTCCCGGAGGTTTGCGAGGGCCCCAACCAGTTCCCTGCGCTGGCGGACCTGCGAAAAGTTCGGACGGGGTCCGGCGATGTGCGCGAGGTTGTGCTGATCGACCACGAGGAGGACCAGGGGCTACTGGCGGTGGAGGAGCAGCTGAGCGAGGCCATGGAGGAGGCCAAGCCCGCGGACGTGGCCGCCAGGATACAGGTGGTCGCCCGTGTTGTGTGTGAGCGGTTCGGCGGCGCCTACGACACCGAGGCGGCACTGGACCACTTCTGGCACGCCTCCAGCGCGGCGGAGAAGCGGCGTACACGCTCGGCGGTGGTCCCGCTGTGCCGGCTGGATGTGGGCTCCGCCCGCCACCGCGCGCTGCTGTTCAAGGTGCTGGCGGACGCCGCCAAGCTGCCGTGTCGCCTGGTGCGCGGCGCCGCGCTGTGCGGCAGCGAGGCCGGCGTGGTGGTGCTGGTGGCGGTGCCGGCGGCCACTGGGGCCGGCGGGGGCAGTCGCAGCGGTGGGGAGTGGGTGGTGGACCTGGTGTACGAGCCGGGGCGGCTGTACGGGCCGCAGGAGTACTGCGCGCTGGTCAAATCCAAGCGGACACGCTCGGACAGCTGGCACCGCAACGGCTCCGCCTCCACGCTTGCGGCGGCCGTGGAGACGTCGGCGGTCAGCAGCAGCAGCGCCAGCAGCGTGGCCACCGTGAGCACACCCGCTGCGGTGACGGGCGCGGCCGGGTCGGGCGAGGCTTTGGGGCCCGCCTCCGGCAACCTGCTGACCGCGCCGCCCCACTCCGTCTCCACTGCCTCTCTTCAGTCAGCAGCCGCCGCGGCAGCAGGGTCCACGGGCTCGCAGTCCACGCCGGCGCTGAGCAGCCCGCGCACGGCGCTGCCGCGGCCGTTGGTGGCGGTGCCGCCGGTGCCGGGCCCGGGCGCCTTTAGCTCCTCCCTGCCCAACTCGGGCGGCGGCAGCAGCATGCACGGGCACGGACAGCACGGCGGCGGCGTGTGGGGCTCAGGCCTGAGCGTGCACCCGCAGGGGCAGCACGGCGGTGGCAGCGGCAGCGGCGGCGCCGGCACCGGCGCTGGTGCCGGCGGCGCTGGGCCGGCCATTGCCGGTAGCCGCGTGCGCTTCACCATCACCGACCTTCCCAAGTCGGGCAGCGGCACGCCGCACGTGTCCACCTCCATCACGACCGCGTCCTCCTCTTCGCCGCACGGGCACCTGAGCACATTGGGCGCGGGCGGGCACGCGGCACCGGGGGCGTTGCACTCGAGCGGGGGCTCGGCGGGCGCGACGGTGGGCTCAGCGCCGCATGCGTCCTCGCATGTGCCGCACGTGCGAATAGGGCCAGTGGCGGCGGGGCCGACCGGCGGCGCGGGCGCGTTGCAGCACTGCACCGCCATCGCGCCGCCGCCAGGCACTGCTGCCGGCCCGGGGCCAGGGTCAGCGGCGGCCGCTGGGAGTTCTGGCGTTGGCGGCCCCGCGTCCCGGCATGCGAACCTACCGCACAGTAAAGCGCGGTCCATGTTGGACCTGCACGGCAACAGCGTTGGCGGCGACCTCATCCGCCTCGACTCGGAGCCGCTGCCGCCGCCGGAGGTTTGTCCCACGCCCACCGGCGCGGGGCACCACCACCCGCCGCACGTCACGGCGGCGCAGGTGCCGCACAAGCAGCAGGCGTCGCTGGACGCAAACGGCTGGGTGAAGTTCAGCGGCAGCTTCGGCCGTGCGCCCACGCCGCACAAGGATGAGGCGACGGGGCACACCCCGTCGCGGCTGGGCCAGCAGGGCGCGCCTCCGCCGTCGGTGGCGCCAGGCCAGCTGGGCGCGTCCCTCCTGGCAGCAGCCGGCGCCAACGGTATGCCCACACACCCGCACCCACAGCAGCAGCCGCGCCAGCCGCACCAGCCCCAGCTGCCCACGCACATGGAGTCCTCCGGCAGCCTGACCGGCATGGGCAACCCGCCTTCGCCAGCAGACAGTGCCGGCAACGGCAACGGCAACGGCGGCTCCGGCTCCGGGTCGGGCGCCCACTGCAACGGCATCTCCTCAGCCTCGTCGGGCCTCGCGGCGCAGCCGACGCTGTCGGCGATGCCGCCGACGGGGCTGCCTGTGGTCACGACCGGTGCGACGGGGCTGTCTTCGGCTTCGCCGTTCGCGCACTTCATGCTGCCGGGGGGCATGTCGCTGTCGCTGCCTGGCGCCGCCGTGGCGGCCGGTGTGGGCGCGGCTGCGGGCCAGCAGGGCGGCGGCGGGGGCGGCATCAGCACAGAGGCCACCGTCAGCAGCGCAGGCTCCACGCAGGGCGGCGCCGCTGCCACTGCTGCTGCTGCTGCGCCAGCGCAGGGACCAGCGTCCGGCAAGCCACCGACCGGGGCACCAGGCGCAGGTGCCGGGGGGCTGCCGCACGCCACAGTGAGCGCCGCGTCGCCGTTCCAGGCGGCGCAGCTGGGACTGGGCACGGGCCCGCAGCAGCGCAGCTCGCTGCCGCAGCACCTCGCATCCTCCTTCCCCACCCTGCACCCGCAGCACCAGCCCCTGCCGCAGCTGACCTCGCAGCAGCAGCAGCAGCAGCCGAACTTGGCCTCGCCGCCGCTGGCTCCCGGGCAACGGCAGCAGGCGACGCCCACCGGCCTTCCCGCCGGCTTCATGCCCCACGCCGCCACCACCATCACCACCGGCGCGGGCGGCAACGCGCTCTACACGCCGCCGCCTAAGGACGCGGGCACCAGCAGCAAGGCCCCGTCGCCGGCGCTGTCCACGCCGCTGGCGCTCACCGCCTCGTCGGCGCAGTCCACACCGGGCAATGCGGCGCCGGTCGAGAGCATACCCTTCGCCGACCTGTCGCCCTGGTACAATGGCACCAACGCCAACCCAGCCGCGGCCGGCGCCACCGGCGGGGGTGCGGCGGGCGGCAGGGCGGGCGCGGGTGTCGGTGCAGGCCGCCCAGGCCAGGGAGGGTTGCTGCCGCCGGCACAGGCGTCCACCGCTGACCCTGCGGAGGACAGGGCGAGCAAGGCGCGCAGTGCGACCTTCTTCGCCGACCTCTCGCCCTTCAACAACGGAGTCGGCGGCCCTGGCGGCGGCGCCGGTGGGCGCGACAACACGCCGCCGGGCGGCCACGCCCGCGGCGCCGGCCGCCAGTCGCCCATTGTGGAGATGCCCAGCAGCGACAACAGCCGCGACACCACGCCGCGTATGTCCTTCACCAACGTCCCGGACAACGGCCACATGCTGCTGCCTGGTGGCGGCGCCGGCGGGCCGTCGTCATGGAGCGAGAGCACCGTTGACATGATGGGACGGCTGCGGATAGGCACGGCCTCGGGCACGGGCATGGGCAGCCGCGCTGATGCGTCGGTGGGCCGGCTGGGCTCGCACGGGCACCACGCGTCGGCCGGCAGTGGCGGCGGCCAGCTGGTGCTGCACGGGCAGTCGATGCAGCAGATGCATTTGGCCACCACCACGGGGCAGGGGCAGACGTTTGCGCCCATGGGCCAGGCGATGGGCGCGGGAACGGGGCTGGGGCAGGCGGCGGCGGCGGCGGCGGTGGCGGAGCAGCAGCGGCAGCGCGAGATGGCCATCACGCTGTACCAGCAGGGCATGCAGGGCGGCCCCAACAGCCTGCAGCTCATTAGCCAGGCCATGGCGCTGGCACAGGCGGCGGGCATGATCAACCTCAACCCCACCCCCGGCGCGGGCGCGATGACCAACCTGGCCCACATGCAGCAGATGCACGTGATGCAGTCGCCGTTTGGCGCACCCGCCGGCTGGCCGCATGGGCTCGGGCACGGGCACGGGCCGCAGCAGGGCCAGGGCTTTGGCGGTGCGCAGCAGCCGCTGCTGCTCGCCCCGCAGCAGATGGGGCTGTTGGGCATGGGGCCGGGCGCCATGGGCGGAGGAGCAGGGGCGGTGCAGGGCCCCGGCACCGCGCTGCACCCCTGGGCGGCGCAGGCGTGGGTTGCCGCGAACCAGCACCAGCAACACCAGCAGCAGCAGCTGCAGCAGCAGGTCCCGACCTTCCAGCCCCATTTCCCGCCGCCGCAGCCCGGCGGCGGCGCGCAGAGCTTGTCGCAGCAGCAGCATCAGCAACAGCAGCAGCGGCAGCAGTCCGCCTTTATGATGCACTCGGCGTTCATGCAGCAGCAACAGGGCATGGCGCAGCAACAGCAGCTTCATCAACATCAACAGCAGCAGCAACAGGCGCACATGGAACGCAACTCCAGCTTCGCTACCACTACGACCACCACGACCACCGTCGTCCGCCAGACGACGCAAGTGGTGGAGACATCCGCAGCCGCCGTGTCCTCGGCGCAGCAGCAGGGTGGCGTGGCGTCAGCAGCTGCCGGCGCCATCGGCCTCGCGCACGAGATGACAATACCGTCGGCGTCGCGGCTAGCGGCGCTGCAGGCCGCCGGCGCGGCGGCGGCGGCGGGCGGTGTCTCGGCTGTGAGCGACGGCGGCGCTGCAGGCGTGAGCTCTCCTCTGGGCCTGCAGCCGACGCTGTCTGTGACGTCCACCATGCCTCTGCCGCCGCACTACAAAGACCTGGAGATCGACCCCAAGGAGCTCACGCTGGGGCAGCGCATCGGCATTGGCAGCTACGGCGAGGTGTACAAGGGCAGCTGGCGCGGCACGGAGGTTGCAGTGAAGCGCTTCCTGGAGCAAAACCTGTCGCCGCCCACCATCCGCGACTTCCGTGACGAGGTGCTCATCATGAGCAAGCTGCGCCACCCCAACATCGTGCTGTTCATGGGCGCCGTCACGCAGAGCAACCAGCTGGCCATCGTGACGCAGTTTGTGGCGCGCGGCAGTCTGTTCCGGCTGCTGCACCGCACCAAGGAGGTGCTGGACCCGCGCCGCCGCCTCAACATGTCGCTGGACATTGCCAAGGGCATGGAGTACCTGCACAACTGCAAGCCGGTGCTGGTGCACCGCGACCTGAAGAGCCCCAACCTACTGGTGGACCGCGACTGGACCGTCAAGGTGTGCGACTTCGGGCTGAGCAAGGTCAAGATGGACACCTTCCTCACAGCCAAGACGCAGGGCGGGTCTCCCGCCTGGATGGCCCCCGAGATTTTGCGCTCCGAGCGCTGCGACGAAAAGTCCGACGTGTTCAGCTTCGGCGTCATCCTGTACGAGCTGGTCACGGGCCGGGAGCCCTGGGAGGAGCTCAACCCCATGCAGGTGGTGGGCGTGGTTGGATTCAACGGCCAGCGCATGGACCTGCCGCCGGATCTGGATCCGGGCGTGACCGCCCTGATCACGGCATGCTGGGCGGACAAGCCCGCGGACCGGCCCTCGTTCAGTCAGATCCTGGCGACCTTGACCACGTGGAGCGAGCTGCGGCCCACGGCCGAGGTAATGGAGCGACAGGCGGCGGCGGCGCGCGCGCGGCAGGCGCGGCAGCAAGGTGGCGGCGGTGGTGGTGGCGGCGGCGGCGGCGCGTGA


Protein sequences

Name Description Sequence
Cre03.g194100.t1.1 protein tyrosine kinase family protein (best arabidopsis hit)

MNYQQGPQSYPQQYAPPQPTSEEQAISIALAQSVVDHEAWRHRERELQAAQAHRVVKSSAAEAASQKFWREGSLGYGEVVADGFYDIYGDFPEVCEGPNQFPALADLRKVRTGSGDVREVVLIDHEEDQGLLAVEEQLSEAMEEAKPADVAARIQVVARVVCERFGGAYDTEAALDHFWHASSAAEKRRTRSAVVPLCRLDVGSARHRALLFKVLADAAKLPCRLVRGAALCGSEAGVVVLVAVPAATGAGGGSRSGGEWVVDLVYEPGRLYGPQEYCALVKSKRTRSDSWHRNGSASTLAAAVETSAVSSSSASSVATVSTPAAVTGAAGSGEALGPASGNLLTAPPHSVSTASLQSAAAAAAGSTGSQSTPALSSPRTALPRPLVAVPPVPGPGAFSSSLPNSGGGSSMHGHGQHGGGVWGSGLSVHPQGQHGGGSGSGGAGTGAGAGGAGPAIAGSRVRFTITDLPKSGSGTPHVSTSITTASSSSPHGHLSTLGAGGHAAPGALHSSGGSAGATVGSAPHASSHVPHVRIGPVAAGPTGGAGALQHCTAIAPPPGTAAGPGPGSAAAAGSSGVGGPASRHANLPHSKARSMLDLHGNSVGGDLIRLDSEPLPPPEVCPTPTGAGHHHPPHVTAAQVPHKQQASLDANGWVKFSGSFGRAPTPHKDEATGHTPSRLGQQGAPPPSVAPGQLGASLLAAAGANGMPTHPHPQQQPRQPHQPQLPTHMESSGSLTGMGNPPSPADSAGNGNGNGGSGSGSGAHCNGISSASSGLAAQPTLSAMPPTGLPVVTTGATGLSSASPFAHFMLPGGMSLSLPGAAVAAGVGAAAGQQGGGGGGISTEATVSSAGSTQGGAAATAAAAAPAQGPASGKPPTGAPGAGAGGLPHATVSAASPFQAAQLGLGTGPQQRSSLPQHLASSFPTLHPQHQPLPQLTSQQQQQQPNLASPPLAPGQRQQATPTGLPAGFMPHAATTITTGAGGNALYTPPPKDAGTSSKAPSPALSTPLALTASSAQSTPGNAAPVESIPFADLSPWYNGTNANPAAAGATGGGAAGGRAGAGVGAGRPGQGGLLPPAQASTADPAEDRASKARSATFFADLSPFNNGVGGPGGGAGGRDNTPPGGHARGAGRQSPIVEMPSSDNSRDTTPRMSFTNVPDNGHMLLPGGGAGGPSSWSESTVDMMGRLRIGTASGTGMGSRADASVGRLGSHGHHASAGSGGGQLVLHGQSMQQMHLATTTGQGQTFAPMGQAMGAGTGLGQAAAAAAVAEQQRQREMAITLYQQGMQGGPNSLQLISQAMALAQAAGMINLNPTPGAGAMTNLAHMQQMHVMQSPFGAPAGWPHGLGHGHGPQQGQGFGGAQQPLLLAPQQMGLLGMGPGAMGGGAGAVQGPGTALHPWAAQAWVAANQHQQHQQQQLQQQVPTFQPHFPPPQPGGGAQSLSQQQHQQQQQRQQSAFMMHSAFMQQQQGMAQQQQLHQHQQQQQQAHMERNSSFATTTTTTTTVVRQTTQVVETSAAAVSSAQQQGGVASAAAGAIGLAHEMTIPSASRLAALQAAGAAAAAGGVSAVSDGGAAGVSSPLGLQPTLSVTSTMPLPPHYKDLEIDPKELTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFMGAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATLTTWSELRPTAEVMERQAAAARARQARQQGGGGGGGGGGGA*

Domains

Domain Start-End Description Sequence

Seg: seg
3-19 seg

YQQGPQSYPQQYAPPQP

HMMPfam: PF14381
59-272 EDR1,Ethylene-responsive protein kinase Le-CTR1

SAAEAASQKFWREGSLGYGEVVADGFYDIYGDFPEVCEGPNQFPALADLRKVRTGSGDVREVVLIDHEEDQGLLAVEEQLSEAMEEAKPADVAARIQVVARVVCERFGGAYDTEAALDHFWHASSAAEKRRTRSAVVPLCRLDVGSARHRALLFKVLADAAKLPCRLVRGAALCGSEAGVVVLVAVPAATGAGGGSRSGGEWVVDLVYEPGRLY

Seg: seg
148-161 seg

ADVAARIQVVARVV

Seg: seg
236-258 seg

AGVVVLVAVPAATGAGGGSRSGG

Seg: seg
296-333 seg

SASTLAAAVETSAVSSSSASSVATVSTPAAVTGAAGSG

Seg: seg
350-371 seg

SVSTASLQSAAAAAAGSTGSQS

Seg: seg
381-397 seg

ALPRPLVAVPPVPGPGA

Seg: seg
399-429 seg

SSSLPNSGGGSSMHGHGQHGGGVWGSGLSVH

Seg: seg
435-459 seg

GGGSGSGGAGTGAGAGGAGPAIAGS

Seg: seg
479-489 seg

STSITTASSSS

Seg: seg
497-522 seg

LGAGGHAAPGALHSSGGSAGATVGSA

Seg: seg
535-547 seg

GPVAAGPTGGAGA

Seg: seg
555-582 seg

APPPGTAAGPGPGSAAAAGSSGVGGPAS

Seg: seg
613-638 seg

EPLPPPEVCPTPTGAGHHHPPHVTAA

Seg: seg
690-704 seg

APGQLGASLLAAAGA

Seg: seg
708-728 seg

PTHPHPQQQPRQPHQPQLPTH

Seg: seg
749-762 seg

GNGNGNGGSGSGSG

Seg: seg
820-840 seg

GAAVAAGVGAAAGQQGGGGGG

Seg: seg
848-890 seg

SSAGSTQGGAAATAAAAAPAQGPASGKPPTGAPGAGAGGLPHA

Seg: seg
924-954 seg

PTLHPQHQPLPQLTSQQQQQQPNLASPPLAP

Seg: seg
973-985 seg

AATTITTGAGGNA

Seg: seg
1040-1080 seg

GTNANPAAAGATGGGAAGGRAGAGVGAGRPGQGGLLPPAQA

Seg: seg
1106-1126 seg

NNGVGGPGGGAGGRDNTPPGG

Seg: seg
1168-1180 seg

GGGAGGPSSWSES

Seg: seg
1210-1223 seg

GSHGHHASAGSGGG

Seg: seg
1251-1279 seg

GQAMGAGTGLGQAAAAAAVAEQQRQREMA

Seg: seg
1338-1394 seg

GAPAGWPHGLGHGHGPQQGQGFGGAQQPLLLAPQQMGLLGMGPGAMGGGAGAVQGPG

Seg: seg
1396-1456 seg

ALHPWAAQAWVAANQHQQHQQQQLQQQVPTFQPHFPPPQPGGGAQSLSQQQHQQQQQRQQS

Seg: seg
1463-1489 seg

AFMQQQQGMAQQQQLHQHQQQQQQAHM

Seg: seg
1497-1536 seg

TTTTTTTTVVRQTTQVVETSAAAVSSAQQQGGVASAAAGA

Seg: seg
1547-1579 seg

SASRLAALQAAGAAAAAGGVSAVSDGGAAGVSS

superfamily: SSF56112
IPR011009
1581-1884 Protein kinase-like (PK-like)
Protein kinase-like domain

LGLQPTLSVTSTMPLPPHYKDLEIDPKELTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFMGAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATLTTWSELRPTAEVMERQAAAARAR

Gene3D: G3DSA:3.30.200.20
1585-1670 no description

PTLSVTSTMPLPPHYKDLEIDPKELTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFM

HMMPanther: PTHR23257
1601-1892 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

DLEIDPKELTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFMGAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATLTTWSELRPTAEVMERQAAAARARQARQQGGG

HMMPanther: PTHR23257:SF80
1601-1892 MAP3K DELTA-1 PROTEIN KINASE,MAP3K DELTA-1 PROTEIN KINASE

DLEIDPKELTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFMGAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATLTTWSELRPTAEVMERQAAAARARQARQQGGG

HMMSmart: SM00219
IPR020635
1609-1861 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFMGAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATL

ProfileScan: PS50011
IPR000719
1609-1865 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFMGAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATLTTWS

HMMSmart: SM00220
IPR002290
1609-1865 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFMGAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATLTTWS

HMMPfam: PF07714
IPR001245
1609-1861 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LTLGQRIGIGSYGEVYKGSWRGTEVAVKRFLEQNLSPPTIRDFRDEVLIMSKLRHPNIVLFMGAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATL

PatternScan: PS00107
IPR017441
1615-1636 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGIGSYGEVYKGSWRGTEVAVK

Gene3D: G3DSA:1.10.510.10
1671-1862 no description

GAVTQSNQLAIVTQFVARGSLFRLLHRTKEVLDPRRRLNMSLDIAKGMEYLHNCKPVLVHRDLKSPNLLVDRDWTVKVCDFGLSKVKMDTFLTAKTQGGSPAWMAPEILRSERCDEKSDVFSFGVILYELVTGREPWEELNPMQVVGVVGFNGQRMDLPPDLDPGVTALITACWADKPADRPSFSQILATLT

PatternScan: PS00108
IPR008271
1728-1740 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

LVHRDLKSPNLLV

Seg: seg
1876-1901 seg

RQAAAARARQARQQGGGGGGGGGGGA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox